Fam213a (NM_027464) Mouse Tagged ORF Clone

SKU
MR202457
Fam213a (Myc-DDK-tagged) - Mouse RIKEN cDNA 5730469M10 gene (5730469M10Rik)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Fam213a
Synonyms 5730469M10Rik; Adrx; AU040822; Pamm
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202457 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTATGTGGTCCATCGGTGTGGGAGCTGTGGGGGCCGCTGCTGTGGCACTGCTCCTGGCCAACACAG
ACATGTTTCTGTCCAAGCCCCGAAAAGCAGCACTGGAATATTTGGAAGACATAGACCTGAAAACACTGGA
GAAAGAACCAAGGACATTCAAAGCAAAGGAGCTGTGGGAGAAGAACGGGGCTGTGATTATGGCTGTACGC
AGGCCAGGCTGCTTTCTCTGCCGAGCGGAAGCAGCAGACCTGATGTCCTTGAAGCCCAAGTTGGATGAGC
TAGGTGTCCCTCTCTATGCGGTGGTGAAGGAGCAGGTGAAGAGAGAAGTGGAAGATTTCCAACCTTACTT
CAAAGGGGAAATCTTCCTGGATGAAAAGAAAAAATTCTATGGTCCAGAGAGGCGGAAGATGATGTTCATG
GGCCTCATCCGATTGGGGGTGTGGTATAACTCCTTTCGAGCCTGGAATGGAGGCTTCTCTGGAAACCTAG
AAGGCGAAGGCTTCATCCTTGGAGGAGTTTTTGTGATAGGATCTGGAAAACAGGGCATCCTTCTTGAGCA
CCGAGAAAAAGAATTTGGAGACAGAGTGAACCCACTCTCTGTTCTGGAGGCTGTAAAGAAAATCAAGCTA
CAGACTCCAGCGTCCGGGAGAAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202457 protein sequence
Red=Cloning site Green=Tags(s)

MGMWSIGVGAVGAAAVALLLANTDMFLSKPRKAALEYLEDIDLKTLEKEPRTFKAKELWEKNGAVIMAVR
RPGCFLCRAEAADLMSLKPKLDELGVPLYAVVKEQVKREVEDFQPYFKGEIFLDEKKKFYGPERRKMMFM
GLIRLGVWYNSFRAWNGGFSGNLEGEGFILGGVFVIGSGKQGILLEHREKEFGDRVNPLSVLEAVKKIKL
QTPASGRS

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_027464
ORF Size 654 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_027464.4
RefSeq Size 1537 bp
RefSeq ORF 657 bp
Locus ID 70564
UniProt ID Q9CYH2
Cytogenetics 14 B
MW 24.4 kDa
Summary Involved in redox regulation of the cell (By similarity). Acts as an antioxidant (By similarity). Inhibits TNFSF11-induced NFKB1 and JUN activation and osteoclast differentiation (By similarity). May affect bone resorption and help to maintain bone mass (By similarity). Acts as a negative regulator of macrophage-mediated inflammation by inhibiting macrophage production of inflammatory cytokines, probably through suppression of the MAPK signaling pathway (PubMed:26438880).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Fam213a (NM_027464) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC203242 Fam213a (untagged) - Mouse RIKEN cDNA 5730469M10 gene (5730469M10Rik), (10ug) 10 ug
$300.00
MG202457 Fam213a (tGFP-tagged) - Mouse RIKEN cDNA 5730469M10 gene (5730469M10Rik) 10 ug
$500.00
MR202457L3 Lenti ORF clone of Fam213a (Myc-DDK-tagged) - Mouse RIKEN cDNA 5730469M10 gene (5730469M10Rik) 10 ug
$600.00
MR202457L4 Lenti ORF clone of Fam213a (mGFP-tagged) - Mouse RIKEN cDNA 5730469M10 gene (5730469M10Rik) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.