Rab14 (NM_026697) Mouse Tagged ORF Clone

SKU
MR202359
Rab14 (Myc-DDK-tagged) - Mouse RAB14, member RAS oncogene family (Rab14)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rab14
Synonyms 0610030G24Rik; 2810475J17Rik; A830021G03Rik; AI314285; AI649155; D030017L14Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202359 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAACTGCACCGTACAACTACTCTTACATCTTTAAGTATATTATTATTGGGGATATGGGAGTAGGAA
AATCTTGCTTGCTTCATCAATTTACAGAAAAAAAATTTATGGCTGATTGTCCTCACACAATTGGTGTTGA
ATTTGGTACAAGAATAATTGAAGTTAGTGGTCAAAAAATCAAACTGCAGATTTGGGATACAGCAGGGCAG
GAGCGGTTCAGAGCGGTTACACGGAGCTACTATAGAGGAGCTGCAGGTGCGCTCATGGTGTATGACATCA
CCAGAAGAAGTACATATAACCACTTAAGCAGCTGGTTGACAGACGCAAGGAATCTCACCAATCCAAACAC
TGTAATAATTCTCATAGGAAATAAAGCAGACTTGGAAGCACAGAGAGATGTTACCTATGAAGAAGCCAAA
CAGTTTGCTGAGGAAAACGGCTTATTGTTCCTTGAAGCAAGCGCAAAAACGGGAGAGAATGTAGAAGATG
CTTTTCTTGAGGCTGCCAAGAAAATCTATCAGAACATTCAGGATGGAAGCCTGGATCTGAATGCTGCCGA
GTCTGGTGTACAACACAAACCCTCAGCCCCGCAGGGAGGACGGCTAACCAGTGAACCCCAACCCCAGAGA
GAAGGCTGTGGCTGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202359 protein sequence
Red=Cloning site Green=Tags(s)

MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIGVEFGTRIIEVSGQKIKLQIWDTAGQ
ERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILIGNKADLEAQRDVTYEEAK
QFAEENGLLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQR
EGCGC

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_026697
ORF Size 645 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026697.4
RefSeq Size 3100 bp
RefSeq ORF 648 bp
Locus ID 68365
UniProt ID Q91V41
Cytogenetics 2 B
MW 23.9 kDa
Summary Regulates, together with its guanine nucleotide exchange factor, DENND6A, the specific endocytic transport of ADAM10, N-cadherin/CDH2 shedding and cell-cell adhesion (By similarity). Involved in membrane trafficking between the Golgi complex and endosomes during early embryonic development. Regulates the Golgi to endosome transport of FGFR-containing vesicles during early development, a key process for developing basement membrane and epiblast and primitive endoderm lineages during early postimplantation development. May act by modulating the kinesin KIF16B-cargo association to endosomes (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Rab14 (NM_026697) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC200292 Rab14 (untagged) - Mouse RAB14, member RAS oncogene family (Rab14), (10ug) 10 ug
$300.00
MG202359 Rab14 (tGFP-tagged) - Mouse RAB14, member RAS oncogene family (Rab14) 10 ug
$500.00
MR202359L3 Lenti ORF clone of Rab14 (Myc-DDK-tagged) - Mouse RAB14, member RAS oncogene family (Rab14) 10 ug
$600.00
MR202359L4 Lenti ORF clone of Rab14 (mGFP-tagged) - Mouse RAB14, member RAS oncogene family (Rab14) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.