Fgf21 (NM_020013) Mouse Tagged ORF Clone

SKU
MR202264
Fgf21 (Myc-DDK-tagged) - Mouse fibroblast growth factor 21 (Fgf21)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Fgf21
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202264 representing NM_020013
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAATGGATGAGATCTAGAGTTGGGACCCTGGGACTGTGGGTCCGACTGCTGCTGGCTGTCTTCCTGC
TGGGGGTCTACCAAGCATACCCCATCCCTGACTCCAGCCCCCTCCTCCAGTTTGGGGGTCAAGTCCGGCA
GAGGTACCTCTACACAGATGACGACCAAGACACTGAAGCCCACCTGGAGATCAGGGAGGATGGAACAGTG
GTAGGCGCAGCACACCGCAGTCCAGAAAGTCTCCTGGAGCTCAAAGCCTTGAAGCCAGGGGTCATTCAAA
TCCTGGGTGTCAAAGCCTCTAGGTTTCTTTGCCAACAGCCAGATGGAGCTCTCTATGGATCGCCTCACTT
TGATCCTGAGGCCTGCAGCTTCAGAGAACTGCTGCTGGAGGACGGTTACAATGTGTACCAGTCTGAAGCC
CATGGCCTGCCCCTGCGTCTGCCTCAGAAGGACTCCCCAAACCAGGATGCAACATCCTGGGGACCTGTGC
GCTTCCTGCCCATGCCAGGCCTGCTCCACGAGCCCCAAGACCAAGCAGGATTCCTGCCCCCAGAGCCCCC
AGATGTGGGCTCCTCTGACCCCCTGAGCATGGTAGAGCCTTTACAGGGCCGAAGCCCCAGCTATGCGTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202264 representing NM_020013
Red=Cloning site Green=Tags(s)

MEWMRSRVGTLGLWVRLLLAVFLLGVYQAYPIPDSSPLLQFGGQVRQRYLYTDDDQDTEAHLEIREDGTV
VGAAHRSPESLLELKALKPGVIQILGVKASRFLCQQPDGALYGSPHFDPEACSFRELLLEDGYNVYQSEA
HGLPLRLPQKDSPNQDATSWGPVRFLPMPGLLHEPQDQAGFLPPEPPDVGSSDPLSMVEPLQGRSPSYAS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020013
ORF Size 630 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020013.4, NP_064397.1
RefSeq Size 947 bp
RefSeq ORF 633 bp
Locus ID 56636
UniProt ID Q9JJN1
Cytogenetics 7 B3
MW 23.7 kDa
Summary Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity probably requires the presence of KLB.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Fgf21 (NM_020013) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC204941 Fgf21 (untagged) - Mouse fibroblast growth factor 21 (Fgf21), (10ug) 10 ug
$300.00
MG202264 Fgf21 (tGFP-tagged) - Mouse fibroblast growth factor 21 (Fgf21) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
MR202264L3 Lenti ORF clone of Fgf21 (Myc-DDK-tagged) - Mouse fibroblast growth factor 21 (Fgf21) 10 ug
$600.00
MR202264L4 Lenti ORF clone of Fgf21 (mGFP-tagged) - Mouse fibroblast growth factor 21 (Fgf21) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.