Rab13 (NM_026677) Mouse Tagged ORF Clone

SKU
MR202075
Rab13 (Myc-DDK-tagged) - Mouse RAB13, member RAS oncogene family (Rab13)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rab13
Synonyms 0610007N03Rik; B230212B15Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR202075 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCAAAGCCTACGACCACCTCTTCAAGTTGCTGCTCATCGGGGACTCGGGGGTGGGCAAGACTTGTC
TGATCATTCGCTTTGCAGAGGACAACTTCAACAGCACTTACATCTCTACCATCGGAATTGATTTCAAGAT
CCGAACCGTGGACATAGAGGGGAAGAGGATCAAACTGCAAGTGTGGGACACGGCTGGCCAAGAACGATTC
AAGACAATAACTACCGCCTATTACCGTGGAGCCATGGGCATTATCCTCGTATATGACATCACAGATGAGA
AATCCTTCGAGAATATTCAGAACTGGATGAAAAGCATCAAAGAGAATGCCTCTGCGGGAGTGGAGCGCCT
CCTGCTGGGAAACAAGTGTGACATGGAGGCCAAGCGGCAGGTGCAGAGAGAGCAGGCGGAGAAGTTGGCT
CGAGAGCACAGAATCCGATTTTTTGAGACGAGTGCCAAATCCAGTGTGAATGTGGATGAGGCTTTCAGTT
CCCTGGCCCGTGACATCTTGCTCAAGACAGGAGGCCGGAGATCGGGAACCAACAGTAAGCCCTCAAGCAC
TGGCCTGAAAACATCTGACAAGAAGAAGAACAAGTGCTTGTTAGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR202075 protein sequence
Red=Cloning site Green=Tags(s)

MAKAYDHLFKLLLIGDSGVGKTCLIIRFAEDNFNSTYISTIGIDFKIRTVDIEGKRIKLQVWDTAGQERF
KTITTAYYRGAMGIILVYDITDEKSFENIQNWMKSIKENASAGVERLLLGNKCDMEAKRQVQREQAEKLA
REHRIRFFETSAKSSVNVDEAFSSLARDILLKTGGRRSGTNSKPSSTGLKTSDKKKNKCLLG

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_026677
ORF Size 606 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026677.4
RefSeq Size 1548 bp
RefSeq ORF 609 bp
Locus ID 68328
UniProt ID Q9DD03
Cytogenetics 3 39.21 cM
MW 22.8 kDa
Summary The small GTPases Rab are key regulators of intracellular membrane trafficking, from the formation of transport vesicles to their fusion with membranes. Rabs cycle between an inactive GDP-bound form and an active GTP-bound form that is able to recruit to membranes different sets of downstream effectors directly responsible for vesicle formation, movement, tethering and fusion. That Rab is involved in endocytic recycling and regulates the transport to the plasma membrane of transmembrane proteins like the tight junction protein OCLN/occludin. Thereby, it regulates the assembly and the activity of tight junctions. Moreover, it may also regulate tight junction assembly by activating the PKA signaling pathway and by reorganizing the actin cytoskeleton through the activation of the downstream effectors PRKACA and MICALL2 respectively. Through its role in tight junction assembly, may play a role in the establishment of Sertoli cell barrier. Plays also a role in angiogenesis through regulation of endothelial cells chemotaxis. Also involved in neurite outgrowth. Has also been proposed to play a role in post-Golgi membrane trafficking from the TGN to the recycling endosome. Finally, it has been involved in insulin-induced transport to the plasma membrane of the glucose transporter GLUT4 and therefore may play a role in glucose homeostasis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Rab13 (NM_026677) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MG202075 Rab13 (tGFP-tagged) - Mouse RAB13, member RAS oncogene family (Rab13) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
MR202075L3 Lenti ORF clone of Rab13 (Myc-DDK-tagged) - Mouse RAB13, member RAS oncogene family (Rab13) 10 ug
$600.00
MR202075L4 Lenti ORF clone of Rab13 (mGFP-tagged) - Mouse RAB13, member RAS oncogene family (Rab13) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.