Rnf183 (NM_153504) Mouse Tagged ORF Clone

SKU
MR201808
Rnf183 (Myc-DDK-tagged) - Mouse ring finger protein 183 (Rnf183)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rnf183
Synonyms 5830442J12Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201808 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCGAACCACAGGGCCAGGAGCTCAGAGCCGAGTGCCCTGTCTGCTGGAACCCTTTCAACAACACAT
TCCACACCCCCAAAGTGCTAGACTGCTGTCACTCCTTCTGTGTGGAATGCCTGGCCCACCTCAGCCTGGT
AACCCCAGCCAGGCGCCGCTTGCTCTGCCCACTCTGTCGTCAGCCCACCGTGCTGGCTTCAGGGCAGCCA
GTCACTGACTTGCCTACAGACACTGCCATGCTGACCCTGCTCCGCCTAGAGCCCCACCATGTCATCCTAG
AGGGCCACCAGCTCTGTCTCAAGGACCAGCCCAAGAGCCGCTACTTCCTGCGTCAGCCTCGGGTCTACAC
CCTGGACCTTGGCGCTGAGCCTGGGAGCCAGACTGGGCTCCCTCAGGACACAGCCCCTGACACCAGGCCG
GTGCCCATCCCCAGTCACTACTCTCTCAGAGAGTGTGTCCGCAACCCTCACTTCCGGATCTTCGCCTATC
TGATGGCTGTCATCCTCAGTGTCACCCTGCTGCTCATCTTCTCCATCTTTTGGACTAAGCAGTTCTTTTG
GGGCATGGGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR201808 protein sequence
Red=Cloning site Green=Tags(s)

MSEPQGQELRAECPVCWNPFNNTFHTPKVLDCCHSFCVECLAHLSLVTPARRRLLCPLCRQPTVLASGQP
VTDLPTDTAMLTLLRLEPHHVILEGHQLCLKDQPKSRYFLRQPRVYTLDLGAEPGSQTGLPQDTAPDTRP
VPIPSHYSLRECVRNPHFRIFAYLMAVILSVTLLLIFSIFWTKQFFWGMG

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_153504
ORF Size 570 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_153504.4
RefSeq Size 1404 bp
RefSeq ORF 573 bp
Locus ID 76072
UniProt ID Q8QZS5
Cytogenetics 4 B3
MW 21.6 kDa
Summary Acts as a E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins (PubMed:29300766). Triggers apoptosis in response to prolonged ER stress by mediating the polyubiquitination and subsequent proteasomal degradation of BCL2L1 (By similarity). May collaborate with FATE1 to restrain BIK protein levels thus regulating apoptotic signaling (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Rnf183 (NM_153504) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MG201808 Rnf183 (tGFP-tagged) - Mouse ring finger protein 183 (Rnf183) 10 ug
$500.00
MR201808L3 Lenti ORF clone of Rnf183 (Myc-DDK-tagged) - Mouse ring finger protein 183 (Rnf183) 10 ug
$600.00
MR201808L4 Lenti ORF clone of Rnf183 (mGFP-tagged) - Mouse ring finger protein 183 (Rnf183) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.