Rap2c (NM_172413) Mouse Tagged ORF Clone

SKU
MR201665
Rap2c (Myc-DDK-tagged) - Mouse RAP2C, member of RAS oncogene family (Rap2c)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rap2c
Synonyms 2010200P20Rik; AI194294; AL022976
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201665 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGGAATACAAGGTAGTGGTGTTAGGGAGCGGAGGGGTTGGCAAATCTGCCCTCACCGTGCAGTTTG
TCACCGGGACTTTCATTGAGAAATATGACCCCACCATTGAAGATTTCTACCGCAAAGAGATCGAAGTGGA
CTCTTCCCCGTCAGTACTGGAAATCCTGGACACCGCAGGAACCGAGCAGTTTGCCTCCATGAGAGATCTG
TACATCAAGAACGGCCAAGGTTTCATCCTGGTGTATAGTTTGGTTAATCAACAGTCTTTTCAGGATATCA
AGCCAATGAGAGATCAGATTGTGAGAGTGAAGAGATACGAGAAAGTCCCACTCATCCTAGTGGGAAACAA
AGTGGATCTGGAACCAGAGAGAGAGGTTATGTCTTCCGAAGGCAGAGCTCTGGCTCAAGAATGGGGCTGT
CCTTTCATGGAAACGTCAGCAAAAAGTAAATCAATGGTGGATGAACTTTTTGCTGAGATCGTCAGGCAAA
TGAACTATTCATCCCTGCCCGAGAAGCAAGATCAGTGTTGTACAACTTGTGTTGTCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR201665 protein sequence
Red=Cloning site Green=Tags(s)

MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDL
YIKNGQGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGC
PFMETSAKSKSMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_172413
ORF Size 549 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_172413.2, NP_766001.1
RefSeq Size 3562 bp
RefSeq ORF 552 bp
Locus ID 72065
UniProt ID Q8BU31
Cytogenetics X A5
MW 20.7 kDa
Summary Small GTP-binding protein which cycles between a GDP-bound inactive and a GTP-bound active form. May play a role in cytoskeletal rearrangements and regulate cell spreading through activation of the effector TNIK. May play a role in SRE-mediated gene transcription.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Rap2c (NM_172413) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC207714 Rap2c (untagged) - Mouse RAP2C, member of RAS oncogene family (Rap2c), (10ug) 10 ug
$330.00
MR201665L3 Lenti ORF clone of Rap2c (Myc-DDK-tagged) - Mouse RAP2C, member of RAS oncogene family (Rap2c) 10 ug
$600.00
MR201665L4 Lenti ORF clone of Rap2c (mGFP-tagged) - Mouse RAP2C, member of RAS oncogene family (Rap2c) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.