Gcg (NM_008100) Mouse Tagged ORF Clone

SKU
MR201620
Gcg (Myc-DDK-tagged) - Mouse glucagon (Gcg)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Gcg
Synonyms Gl; GLP; GLP-1; Glu; P; PPG
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201620 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGACCATTTACTTTGTGGCTGGATTGCTTATAATGCTGGTGCAAGGCAGCTGGCAGCACGCCCTTC
AAGACACAGAGGAGAACCCCAGATCATTCCCAGCTTCCCAGACAGAAGCGCATGAGGACCCTGATGAGAT
GAATGAAGACAAACGCCACTCACAGGGCACATTCACCAGCGACTACAGCAAATACCTGGACTCCCGCCGT
GCCCAAGATTTTGTGCAGTGGTTGATGAACACCAAGAGGAACCGGAACAACATTGCCAAACGTCATGATG
AATTTGAGAGGCATGCTGAAGGGACCTTTACCAGTGATGTGAGTTCTTACTTGGAGGGCCAGGCAGCAAA
GGAATTCATTGCTTGGCTGGTGAAAGGCCGAGGAAGGCGAGACTTCCCAGAAGAAGTCGCCATTGCCGAG
GAACTCGGCCGCAGGCACGCTGATGGCTCCTTCTCTGACGAGATGAGCACCATTCTGGATAATCTTGCCA
CCAGGGACTTCATCAACTGGCTGATTCAAACCAAGATCACTGACAAGAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR201620 protein sequence
Red=Cloning site Green=Tags(s)

MKTIYFVAGLLIMLVQGSWQHALQDTEENPRSFPASQTEAHEDPDEMNEDKRHSQGTFTSDYSKYLDSRR
AQDFVQWLMNTKRNRNNIAKRHDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRGRRDFPEEVAIAE
ELGRRHADGSFSDEMSTILDNLATRDFINWLIQTKITDKK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_008100
ORF Size 540 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_008100.4
RefSeq Size 1091 bp
RefSeq ORF 543 bp
Locus ID 14526
UniProt ID P55095
Cytogenetics 2 35.85 cM
MW 20.9 kDa
Summary This gene encodes glucagon, a pancreatic hormone that counteracts the action of insulin in the bloodstream. The encoded protein is processed to generate glucagon and two other glucagon-like peptides, GLP1 and GLP2. Glucagon stimulates gluconeogenesis, glycogenolysis and lipolysis. GLP1 induces secretion of insulin, suppresses glucagon secretion and inhibits feeding. GLP2 induces intestinal absorption of glucose by stimulating the growth of intestinal cells and preventing apoptosis. [provided by RefSeq, Apr 2015]
Write Your Own Review
You're reviewing:Gcg (NM_008100) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC200864 Gcg (untagged) - Mouse glucagon (Gcg), (10ug) 10 ug
$300.00
MG201620 Gcg (tGFP-tagged) - Mouse glucagon (Gcg) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
MR201620L3 Lenti ORF clone of Gcg (Myc-DDK-tagged) - Mouse glucagon (Gcg) 10 ug
$600.00
MR201620L4 Lenti ORF clone of Gcg (mGFP-tagged) - Mouse glucagon (Gcg) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.