Ptn (NM_008973) Mouse Tagged ORF Clone
SKU
MR201396
Ptn (Myc-DDK-tagged) - Mouse pleiotrophin (Ptn)
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Mouse Tagged ORF Clone |
---|---|
Target Symbol | Ptn |
Synonyms | HARP; HB-GAM; HBBN; HBGF-8; HBNF; OSF; Osf-1; Osf1 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>MR201396 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTCGTCCCAGCAATATCAGCAGCAACGTAGAAAATTTGCAGCTGCCTTCCTGGCATTGATTTTCATCT TGGCAGCTGTGGACACTGCTGAGGCCGGGAAGAAAGAAAAACCTGAAAAAAAGGTGAAAAAGTCTGACTG TGGAGAATGGCAGTGGAGTGTGTGCGTGCCTACCAGCGGGGACTGTGGATTGGGCACCCGGGAGGGCACT CGCACTGGCGCCGAGTGCAAACAGACCATGAAGACTCAGAGATGTAAGATCCCTTGCAACTGGAAGAAGC AGTTTGGAGCTGAGTGCAAGTACCAGTTCCAGGCTTGGGGAGAATGTGACCTCAATACCGCCTTGAAGAC CAGAACTGGCAGCCTGAAGCGAGCTCTGCACAATGCTGACTGTCAGAAAACTGTCACCATCTCCAAGCCC TGTGGCAAGCTCACCAAGCCCAAGCCTCAAGCGGAGTCAAAGAAGAAGAAAAAGGAAGGCAAGAAACAGG AGAAGATGCTGGAT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR201396 protein sequence
Red=Cloning site Green=Tags(s) MSSQQYQQQRRKFAAAFLALIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGT RTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNADCQKTVTISKP CGKLTKPKPQAESKKKKKEGKKQEKMLD myc-FLAG tag |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_008973 |
ORF Size | 504 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_008973.1, NM_008973.2, NP_032999.1 |
RefSeq Size | 2021 bp |
RefSeq ORF | 507 bp |
Locus ID | 19242 |
UniProt ID | P63089 |
Cytogenetics | 6 15.48 cM |
MW | 18.9 kDa |
Summary | Secreted growth factor that mediates its signal through cell-surface proteoglycan and non-proteoglycan receptors (By similarity). Binds cell-surface proteoglycan receptor via their chondroitin sulfate (CS) groups (By similarity). Thereby regulates many processes like cell proliferation, cell survival, cell growth, cell differentiation and cell migration in several tissues namely neuron and bone (PubMed:15121180, PubMed:30497772, PubMed:27445335, PubMed:19442624). Also plays a role in synaptic plasticity and learning-related behavior by inhibiting long-term synaptic potentiation (PubMed:11414790, PubMed:25000129). Binds PTPRZ1, leading to neutralization of the negative charges of the CS chains of PTPRZ1, inducing PTPRZ1 clustering, thereby causing the dimerization and inactivation of its phosphatase activity leading to increased tyrosine phosphorylation of each of the PTPRZ1 substrates like ALK or AFAP1L2 in order to activate the PI3K-AKT pathway (PubMed:27445335). Through PTPRZ1 binding controls oligodendrocyte precursor cell differentiation by enhancing the phosphorylation of AFAP1L2 in order to activate the PI3K-AKT pathway (PubMed:27445335). Forms a complex with PTPRZ1 and integrin alpha-V/beta-3 (ITGAV:ITGB3) that stimulates endothelial cell migration through SRC dephosphorylation and activation that consequently leads to ITGB3 'Tyr-773' phosphorylation (By similarity). In adult hippocampus promotes dendritic arborization, spine development, and functional integration and connectivity of newborn granule neurons through ALK by activating AKT signaling pathway (PubMed:30497772). Binds GPC2 and chondroitin sulfate proteoglycans (CSPGs) at the neuron surface, leading to abrogation of binding between PTPRS and CSPGs and neurite outgrowth promotion (By similarity). Binds SDC3 and mediates bone formation by recruiting and attaching osteoblasts/osteoblast precursors to the sites for new bone deposition (By similarity). Binds ALK and promotes cell survival and cell proliferation through MAPK pathway activation (By similarity). Inhibits proliferation and enhances differentiation of neural stem cells by inhibiting FGF2-induced fibroblast growth factor receptor signaling pathway (PubMed:15121180). Mediates regulatory mechanisms in normal hemostasis and in hematopoietic regeneration and in maintaining the balance of myeloid and lymphoid regeneration (PubMed:21791434). In addition may play a role in the female reproductive system, auditory response and the progesterone-induced decidualization pathway (PubMed:17121547, PubMed:28657144, PubMed:16619002).[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
MC204839 | Ptn (untagged) - Mouse pleiotrophin (Ptn), (10ug) | 10 ug |
$300.00
|
|
MG201396 | Ptn (tGFP-tagged) - Mouse pleiotrophin (Ptn) | 10 ug |
$500.00
|
|
MR201396L3 | Lenti ORF clone of Ptn (Myc-DDK-tagged) - Mouse pleiotrophin (Ptn) | 10 ug |
$600.00
|
|
MR201396L4 | Lenti ORF clone of Ptn (mGFP-tagged) - Mouse pleiotrophin (Ptn) | 10 ug |
$600.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.