Atp5d (NM_025313) Mouse Tagged ORF Clone

SKU
MR201389
Atp5d (Myc-DDK-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (Atp5d), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00 MSRP $300.00 MSRP $300.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Atp5d
Synonyms 0610008F14Rik; 1500000I11Rik; AA960090; AI876556; AU020773; C85518
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201389 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGCCCGCCTCACTGCTTCGTCACCCGGGCCTGCGCCGCCTGATGCTTCAGGCGCGTACATACGCCG
AGGCCGCCGCTGCACCTGCCCCCGCCGCCGGGCCCGGACAGATGTCCTTCACCTTTGCCTCCCCGACGCA
GGTGTTCTTTGACAGTGCCAACGTCAAGCAAGTGGACGTGCCTACGCTGACTGGAGCCTTTGGCATCTTG
GCATCCCATGTCCCCACACTACAGGTCCTACGGCCTGGGCTGGTAGTGGTTCACACAGAAGACGGCACCA
CGACTAAGTACTTTGTGAGCAGCGGCTCCGTCACTGTGAATGCCGACTCCTCTGTGCAGTTACTAGCTGA
AGAAGCTGTGACACTGGACATGCTGGACCTGGGGGCAGCCCGGGCCAACCTGGAGAAGGCGCAGTCAGAA
CTGTCAGGTGCGGCGGACGAGGCAGCACGGGCTGAGATCCAGATCCGTATTGAGGCCAATGAAGCCCTAG
TGAAGGCCCTGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR201389 protein sequence
Red=Cloning site Green=Tags(s)

MLPASLLRHPGLRRLMLQARTYAEAAAAPAPAAGPGQMSFTFASPTQVFFDSANVKQVDVPTLTGAFGIL
ASHVPTLQVLRPGLVVVHTEDGTTTKYFVSSGSVTVNADSSVQLLAEEAVTLDMLDLGAARANLEKAQSE
LSGAADEAARAEIQIRIEANEALVKALE

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_025313
ORF Size 504 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025313.2
RefSeq Size 931 bp
RefSeq ORF 507 bp
Locus ID 66043
UniProt ID Q9D3D9
Cytogenetics 10 C1
MW 17.6 kDa
Summary Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core, and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP turnover in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(1) domain and of the central stalk which is part of the complex rotary element. Rotation of the central stalk against the surrounding alpha(3)beta(3) subunits leads to hydrolysis of ATP in three separate catalytic sites on the beta subunits.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Atp5d (NM_025313) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC200271 Atp5d (untagged) - Mouse ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (Atp5d), nuclear gene encoding mitochondrial protein, (10ug) 10 ug
$300.00
MG201389 Atp5d (tGFP-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (Atp5d) 10 ug
$500.00
MR201389L3 Lenti ORF clone of Atp5d (Myc-DDK-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (Atp5d), nuclear gene encoding mitochondrial protein 10 ug
$600.00
MR201389L4 Lenti ORF clone of Atp5d (mGFP-tagged) - Mouse ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit (Atp5d), nuclear gene encoding mitochondrial protein 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.