Ndufs4 (NM_010887) Mouse Tagged ORF Clone

SKU
MR201277
Ndufs4 (Myc-DDK-tagged) - Mouse NADH dehydrogenase (ubiquinone) Fe-S protein 4 (Ndufs4), nuclear gene encoding mitochondrial protein
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ndufs4
Synonyms 6720411N02Rik; C1-18k
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201277 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGGGGCGAAGGGCAATGGCTACAGCTGCCATTTCCGTCTGTAGAGTTCCATCCAGGTTCTTGAGCA
CATCCACTTGGAAGCTGGCAGACAACCAGACTCGGGACACACAGCTTATAACAGTTGATGAGAAACTGGA
TATCACAACTTTAACTGGTGTTCCAGAAGAGCACATCAAAACCAGAAAGGTCAGAATCTTTGTTCCTGCT
CGCAATAACATGCAGTCTGGAGTAAACAACACAAAGAAATGGAAGATGGAGTTTGATACCAGAGAGAGAT
GGGAAAATCCTTTGATGGGTTGGGCATCAACCGCTGACCCCCTCTCCAACATGGTTCTGACCTTCAGTGC
CAAAGAAGATGCAATTGCCTTTGCAGAAAAAAACGGATGGAGCTATGATGTGGAAGAGAAGAAGGTTCCG
AAACCCAAGTCCAAGTCTTATGGTGCAAACTTTTCTTGGAACAAAAGAACAAGAGTGTCTACAAAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR201277 protein sequence
Red=Cloning site Green=Tags(s)

MLGRRAMATAAISVCRVPSRFLSTSTWKLADNQTRDTQLITVDEKLDITTLTGVPEEHIKTRKVRIFVPA
RNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSAKEDAIAFAEKNGWSYDVEEKKVP
KPKSKSYGANFSWNKRTRVSTK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_010887
ORF Size 486 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010887.1, NP_035017.1
RefSeq Size 1534 bp
RefSeq ORF 528 bp
Locus ID 17993
UniProt ID Q9CXZ1
Cytogenetics 13 D2.2
MW 18.5 kDa
Summary Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Ndufs4 (NM_010887) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC207332 Ndufs4 (untagged) - Mouse NADH dehydrogenase (ubiquinone) Fe-S protein 4 (Ndufs4), nuclear gene encoding mitochondrial protein, (10ug) 10 ug
$330.00
MG201277 Ndufs4 (tGFP-tagged) - Mouse NADH dehydrogenase (ubiquinone) Fe-S protein 4 (Ndufs4) 10 ug
$350.00
MR201277L1 Lenti ORF clone of Ndufs4 (Myc-DDK-tagged) - Mouse NADH dehydrogenase (ubiquinone) Fe-S protein 4 (Ndufs4), nuclear gene encoding mitochondrial protein 10 ug
$450.00
MR201277L2 Lenti ORF clone of Ndufs4 (mGFP-tagged) - Mouse NADH dehydrogenase (ubiquinone) Fe-S protein 4 (Ndufs4), nuclear gene encoding mitochondrial protein 10 ug
$450.00
MR201277L3 Lenti ORF clone of Ndufs4 (Myc-DDK-tagged) - Mouse NADH dehydrogenase (ubiquinone) Fe-S protein 4 (Ndufs4), nuclear gene encoding mitochondrial protein 10 ug
$450.00
MR201277L4 Lenti ORF clone of Ndufs4 (mGFP-tagged) - Mouse NADH dehydrogenase (ubiquinone) Fe-S protein 4 (Ndufs4), nuclear gene encoding mitochondrial protein 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.