Vkorc1 (NM_178600) Mouse Tagged ORF Clone

SKU
MR201263
Vkorc1 (Myc-DDK-tagged) - Mouse vitamin K epoxide reductase complex, subunit 1 (Vkorc1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Vkorc1
Synonyms D7Wsu86; D7Wsu86e
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201263 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCACCACCTGGAGGAGCCCTGGACTGGTGCGGCTTGCACTGTGCCTCGCTGGCTTAGCCCTCTCAC
TGTACGCACTGCACGTGAAGGCGGCGCGCGCCCGCGATGAGAATTACCGCGCGCTCTGCGATGTGGGCAC
GGCCATCAGCTGTTCCCGCGTCTTCTCCTCTCGGTGGGGCCGGGGCTTTGGGCTGGTGGAGCACATGCTA
GGAGCGGACAGCGTCCTCAACCAATCCAACAGCATATTTGGTTGCCTGTTCTACACCTTACAGCTGTTGT
TAGGTTGCTTGAGGGGACGTTGGGCCTCTATCCTACTGGTGCTGAGTTCCCTGGTGTCCGTCGCTGGTTC
CGTGTACCTGGCCTGGATCCTGTTCTTTGTGTTATATGATTTCTGTATTGTGTGCATTACCACCTATGCC
ATCAATGTGGGTCTGATGTTGCTTAGCTTCCAGAAGGTACCAGAACACAAGACCAAAAAGCAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR201263 protein sequence
Red=Cloning site Green=Tags(s)

MGTTWRSPGLVRLALCLAGLALSLYALHVKAARARDENYRALCDVGTAISCSRVFSSRWGRGFGLVEHML
GADSVLNQSNSIFGCLFYTLQLLLGCLRGRWASILLVLSSLVSVAGSVYLAWILFFVLYDFCIVCITTYA
INVGLMLLSFQKVPEHKTKKH

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_178600
ORF Size 483 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_178600.1, NM_178600.2, NP_848715.1
RefSeq Size 764 bp
RefSeq ORF 486 bp
Locus ID 27973
UniProt ID Q9CRC0
Cytogenetics 7 69.81 cM
MW 17.8 kDa
Summary Vitamin K is essential for blood clotting but must be enzymatically activated. This enzymatically activated form of vitamin K is a reduced form required for the carboxylation of glutamic acid residues in some blood-clotting proteins. The product of this gene encodes the enzyme that is responsible for reducing vitamin K 2,3-epoxide to the enzymatically activated form. Fatal bleeding can be caused by vitamin K deficiency and by the vitamin K antagonist warfarin, and it is the product of this gene that is sensitive to warfarin. In humans, mutations in this gene can be associated with deficiencies in vitamin-K-dependent clotting factors and, in humans and rats, with warfarin resistance. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Vkorc1 (NM_178600) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC204511 Vkorc1 (untagged) - Mouse vitamin K epoxide reductase complex, subunit 1 (Vkorc1), (10ug) 10 ug
$150.00
MG201263 Vkorc1 (tGFP-tagged) - Mouse vitamin K epoxide reductase complex, subunit 1 (Vkorc1) 10 ug
$350.00
MR201263L3 Lenti ORF clone of Vkorc1 (Myc-DDK-tagged) - Mouse vitamin K epoxide reductase complex, subunit 1 (Vkorc1) 10 ug
$450.00
MR201263L4 Lenti ORF clone of Vkorc1 (mGFP-tagged) - Mouse vitamin K epoxide reductase complex, subunit 1 (Vkorc1) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.