Ing5 (BC064674) Mouse Tagged ORF Clone

SKU
MR201124
Ing5 (Myc-DDK-tagged) - Mouse inhibitor of growth family, member 5 (cDNA clone MGC:66742 IMAGE:6400183)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Ing5
Synonyms 1700001C14Rik; 1700027H23Rik; 1810018M11Rik; AI225768
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201124 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGACCTACGAGATGGTGGATAAACACATCCGAAGACTTGATGCTGACCTGGCGCGCTTTGAGGCTG
ACCTGAAGGACAGGATGGATGGAAGTGACTTTGAGAGCACTGGAGCACGGAGCTTGAAAAAAGGCCGGAG
TCAGAAAGAAAAAAGAAGCTCCCGGGGCCGAGGCCGGCGGACGTCAGAAGAGGATACCCCAAAGAAGAAG
AAACATAAAAGCGGGTCTGAGTTTACTGACAGTATCCTATCTGTGCACCCCTCTGATGTGCTGGACATGC
CTGTGGATCCGAATGAGCCTACATACTGCTTGTGCCACCAGGTGTCCTACGGGGAGATGATCGGCTGTGA
CAATCCAGATTGTCCCATTGAGTGGTTTCACTTTGCCTGCGTGGATCTCACCACAAAGCCCAAAGGAAAG
TGGTTTTGTCCACGATGTGTTCAGGAAAAGAGGAAGAAGAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR201124 protein sequence
Red=Cloning site Green=Tags(s)

MQTYEMVDKHIRRLDADLARFEADLKDRMDGSDFESTGARSLKKGRSQKEKRSSRGRGRRTSEEDTPKKK
KHKSGSEFTDSILSVHPSDVLDMPVDPNEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKGK
WFCPRCVQEKRKKK

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN BC064674
ORF Size 462 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC064674, AAH64674
RefSeq Size 4579 bp
RefSeq ORF 464 bp
Locus ID 66262
Cytogenetics 1 D
MW 17.8 kDa
Summary Component of the HBO1 complex which has a histone H4-specific acetyltransferase activity, a reduced activity toward histone H3 and is responsible for the bulk of histone H4 acetylation in vivo. Component of the MOZ/MORF complex which has a histone H3 acetyltransferase activity. May function as a transcriptional coactivator for RUNX2. Inhibits cell growth, induces a delay in S-phase progression and enhances Fas-induced apoptosis in an INCA1-dependent manner (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Ing5 (BC064674) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC206898 Ing5 (untagged) - Mouse inhibitor of growth family, member 5 (cDNA clone MGC:66742 IMAGE:6400183), (10ug) 10 ug
$165.00
MG201124 Ing5 (tGFP-tagged) - Mouse inhibitor of growth family, member 5 (cDNA clone MGC:66742 IMAGE:6400183) 10 ug
$350.00
MR201124L3 Lenti ORF clone of Ing5 (Myc-DDK-tagged) - Mouse inhibitor of growth family, member 5 (cDNA clone MGC:66742 IMAGE:6400183) 10 ug
$450.00
MR201124L4 Lenti ORF clone of Ing5 (mGFP-tagged) - Mouse inhibitor of growth family, member 5 (cDNA clone MGC:66742 IMAGE:6400183) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.