Ube2n (BC034898) Mouse Tagged ORF Clone
SKU
MR201092
Ube2n (Myc-DDK-tagged) - Mouse ubiquitin-conjugating enzyme E2N (cDNA clone MGC:41464 IMAGE:1382079)
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Mouse Tagged ORF Clone |
---|---|
Target Symbol | Ube2n |
Synonyms | 1500026J17Rik, UBC13 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>MR201092 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCCGGGCTGCCCCGCAGGATCATCAAGGAAACCCAGCGTTTGCTGGCAGAACCAGTTCCTGGCATTA AAGCAGAACCAGATGAGAGCAACGCCCGTTATTTTCATGTGGTCATTGCTGGCCCCCAGGATTCCCCCTT TGAGGGAGGGACTTTTAAACTTGAACTATTCCTTCCAGAAGAATACCCAATGGCAGCACCTAAAGTACGT TTCATGACCAAAATTTATCATCCTAATGTAGACAAGTTGGGAAGAATATGTTTAGATATTTTGAAAGATA AGTGGTCCCCAGCACTGCAGATCCGCACAGTTCTGCTATCAATCCAGGCTTTGTTAAGTGCTCCTAATCC AGATGATCCATTAGCAAATGATGTAGCCGAGCAATGGAAGACCAACGAAGCCCAAGCCATAGAAACAGCG AGAGCATGGACTAGGCTATATGCCATGAACAATATT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR201092 protein sequence
Red=Cloning site Green=Tags(s) MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGGTFKLELFLPEEYPMAAPKVR FMTKIYHPNVDKLGRICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETA RAWTRLYAMNNI myc-FLAG tag |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | BC034898 |
ORF Size | 456 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | BC034898, AAH34898 |
RefSeq Size | 743 bp |
RefSeq ORF | 458 bp |
Locus ID | 93765 |
Cytogenetics | 10 C2 |
MW | 17.1 kDa |
Summary | The UBE2V1-UBE2N and UBE2V2-UBE2N heterodimers catalyze the synthesis of non-canonical 'Lys-63'-linked polyubiquitin chains (PubMed:22424771, PubMed:28039360). This type of polyubiquitination does not lead to protein degradation by the proteasome. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage. Acts together with the E3 ligases, HLTF and SHPRH, in the 'Lys-63'-linked poly-ubiquitination of PCNA upon genotoxic stress, which is required for DNA repair. Appears to act together with E3 ligase RNF5 in the 'Lys-63'-linked polyubiquitination of JKAMP thereby regulating JKAMP function by decreasing its association with components of the proteasome and ERAD. Promotes TRIM5 capsid-specific restriction activity and the UBE2V1-UBE2N heterodimer acts in concert with TRIM5 to generate 'Lys-63'-linked polyubiquitin chains which activate the MAP3K7/TAK1 complex which in turn results in the induction and expression of NF-kappa-B and MAPK-responsive inflammatory genes.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
MC206965 | Ube2n (untagged) - Mouse ubiquitin-conjugating enzyme E2N (cDNA clone MGC:41464 IMAGE:1382079), (10ug) | 10 ug |
$165.00
|
|
MG201092 | Ube2n (tGFP-tagged) - Mouse ubiquitin-conjugating enzyme E2N (cDNA clone MGC:41464 IMAGE:1382079) | 10 ug |
$350.00
|
|
MR201092L1 | Lenti ORF clone of Ube2n (Myc-DDK-tagged) - Mouse ubiquitin-conjugating enzyme E2N (cDNA clone MGC:41464 IMAGE:1382079) | 10 ug |
$450.00
|
|
MR201092L2 | Lenti ORF clone of Ube2n (mGFP-tagged) - Mouse ubiquitin-conjugating enzyme E2N (cDNA clone MGC:41464 IMAGE:1382079) | 10 ug |
$450.00
|
|
MR201092L3 | Lenti ORF clone of Ube2n (Myc-DDK-tagged) - Mouse ubiquitin-conjugating enzyme E2N (cDNA clone MGC:41464 IMAGE:1382079) | 10 ug |
$450.00
|
|
MR201092L4 | Lenti ORF clone of Ube2n (mGFP-tagged) - Mouse ubiquitin-conjugating enzyme E2N (cDNA clone MGC:41464 IMAGE:1382079) | 10 ug |
$450.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.