Tifab (NM_145976) Mouse Tagged ORF Clone

SKU
MR201001
Tifab (Myc-DDK-tagged) - Mouse TRAF-interacting protein with forkhead-associated domain, family member B (Tifab), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Tifab
Synonyms MGC32345; MGC37193
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR201001 representing NM_145976.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGAGAGGCCCCTCACAGTCCTGCAGGTGAGCCTGTACCACCCTACACAGGGCCCGGTCGCCTTTGCC
CACGTCCCACAGCAGCTGCAACATGACGCCAGCCGGCTGTTGGTTGGGCGAGGACAGAACACCCATCTC
CAGCTGCAGCTGCCACAGTTGTCTCGCTACCATTTGTCCCTGGAACCCTACCTGGAGAAAGGCAGCAGT
CTGCTGGCCTTCTGCCTCAAGGTGCTGACCCGCAAGAGCTGTGTGTGGGTCAACGGGCTGCCACTGAGG
TACTTGGAGCAGGTTCCCTTGGGCACCATCAACAGAATCTCCTTCTCTGGCATCCAGATGCTAGTCCGC
AAAGAGGGGGGAGCCTCCCTTGAGACCTTTGTCTGCTACTTCCATCTCAGCCCTTCACCCCTGATTTAC
AGACCCAAGGCTCAGGAGACAGATGAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
Protein Sequence
>Peptide sequence encoded by MR201001
Blue=ORF Red=Cloning site Green=Tag(s)

MERPLTVLQVSLYHPTQGPVAFAHVPQQLQHDASRLLVGRGQNTHLQLQLPQLSRYHLSLEPYLEKGSS
LLAFCLKVLTRKSCVWVNGLPLRYLEQVPLGTINRISFSGIQMLVRKEGGASLETFVCYFHLSPSPLIY
RPKAQETDE

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_145976
ORF Size 441 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 3434 bp
RefSeq ORF 444 bp
Locus ID 212937
UniProt ID Q8JZM6
Cytogenetics 13 B1
MW 16.6 kDa
Summary Inhibits TIFA-mediated TRAF6 activation possibly by inducing a conformational change in TIFA.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Tifab (NM_145976) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC202112 Tifab (untagged) - Mouse TRAF-interacting protein with forkhead-associated domain, family member B (Tifab), transcript variant 2, (10ug) 10 ug
$150.00
MG201001 Tifab (tGFP-tagged) - Mouse cDNA sequence BC027057 (BC027057) 10 ug
$350.00
MR201001L3 Lenti ORF clone of Tifab (Myc-DDK-tagged) - Mouse TRAF-interacting protein with forkhead-associated domain, family member B (Tifab), transcript variant 2 10 ug
$450.00
MR201001L4 Lenti ORF clone of Tifab (mGFP-tagged) - Mouse TRAF-interacting protein with forkhead-associated domain, family member B (Tifab), transcript variant 2 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.