C1d (NM_020558) Mouse Tagged ORF Clone

SKU
MR200907
C1d (Myc-DDK-tagged) - Mouse C1D nuclear receptor co-repressor (C1d)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol C1d
Synonyms 1110036E10Rik; AI875855; SUN-CoR
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR200907 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGGTGAAGAAATGAATGAAGATTATCCCGTAGAAATTCACGAGTCTTTAACAGCCCTGGAGAGCT
CCCTGGGTGCTGTGGATGACATGCTGAAGACCATGATGGCTGTTTCTAGAAATGAGTTGTTGCAGAAGTT
GGACCCATTGGAACAAGCAAAGGTGGATTTAGTTTCTGCATACACCTTAAATTCAATGTTTTGGGTTTAT
TTGGCAACTCAAGGAGTTAATCCCAAAGAGCATCCAGTGAAGCAGGAACTGGAAAGAATCAGAGTCTACA
TGAACAGAGTTAAAGAAATAACAGACAAGAAGAAGGCTGCCAAGCTGGACAGAGGTGCTGCTTCGAGATT
TGTCAAGAACGCACTCTGGGAACCCAAAGCAAAAAGCACACCAAAAGTGGCTAATAAAGGGAAAAGCAAA
CAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR200907 protein sequence
Red=Cloning site Green=Tags(s)

MAGEEMNEDYPVEIHESLTALESSLGAVDDMLKTMMAVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVY
LATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAAKLDRGAASRFVKNALWEPKAKSTPKVANKGKSK
H

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_020558
ORF Size 423 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020558.1, NM_020558.2, NM_020558.3, NM_020558.4, NP_065583.2
RefSeq Size 2957 bp
RefSeq ORF 426 bp
Locus ID 57316
UniProt ID O35473
Cytogenetics 11 A2
MW 15.9 kDa
Summary Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA; this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence of supercoiled DNA. Can induce apoptosis in a p53/TP53 dependent manner. May regulate the TRAX/TSN complex formation. Potentiates transcriptional repression by NR1D1 and THRB (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:C1d (NM_020558) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC203692 C1d (untagged) - Mouse C1D nuclear receptor co-repressor (C1d), (10ug) 10 ug
$150.00
MG200907 C1d (tGFP-tagged) - Mouse nuclear DNA binding protein (C1d) 10 ug
$350.00
MR200907L3 Lenti ORF clone of C1d (Myc-DDK-tagged) - Mouse C1D nuclear receptor co-repressor (C1d) 10 ug
$450.00
MR200907L4 Lenti ORF clone of C1d (mGFP-tagged) - Mouse C1D nuclear receptor co-repressor (C1d) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.