Hint1 (NM_008248) Mouse Tagged ORF Clone

SKU
MR200661
Hint1 (Myc-DDK-tagged) - Mouse histidine triad nucleotide binding protein 1 (Hint1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Hint1
Synonyms AA673479; Hint; Ipk1; PKCI-1; PRKCNH1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR200661 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTGACGAGATTGCCAAGGCTCAAGTGGCCCAGCCCGGCGGCGACACGATCTTCGGCAAGATCATCC
GCAAAGAAATCCCCGCCAAGATCATCTTCGAGGACGACCGGTGTCTTGCTTTTCATGACATTTCCCCTCA
AGCACCAACACACTTTCTGGTGATACCCAAGAAGCATATATCCCAGATTTCTGTAGCAGATGATGATGAT
GAAAGTCTTCTAGGACATTTAATGATTGTTGGCAAGAAATGTGCTGCAGATCTGGGCCTGAAGCGCGGGT
ACCGGATGGTGGTGAATGAAGGTGCAGACGGGGGACAGTCTGTCTATCACATTCACCTCCATGTCCTTGG
GGGTCGGCAGATGAACTGGCCTCCTGGT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR200661 protein sequence
Red=Cloning site Green=Tags(s)

MADEIAKAQVAQPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVADDDD
ESLLGHLMIVGKKCAADLGLKRGYRMVVNEGADGGQSVYHIHLHVLGGRQMNWPPG

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_008248
ORF Size 378 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_008248.3
RefSeq Size 576 bp
RefSeq ORF 381 bp
Locus ID 15254
UniProt ID P70349
Cytogenetics 11 B1.3
MW 13.8 kDa
Summary Hydrolyzes purine nucleotide phosphoramidates with a single phosphate group, including adenosine 5'monophosphoramidate (AMP-NH2), adenosine 5'monophosphomorpholidate (AMP-morpholidate) and guanosine 5'monophosphomorpholidate (GMP-morpholidate). Hydrolyzes lysyl-AMP (AMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) generated by lysine tRNA ligase, as well as Met-AMP, His-AMP and Asp-AMP, lysyl-GMP (GMP-N-epsilon-(N-alpha-acetyl lysine methyl ester)) and AMP-N-alanine methyl ester. Can also convert adenosine 5'-O-phosphorothioate and guanosine 5'-O-phosphorothioate to the corresponding nucleoside 5'-O-phosphates with concomitant release of hydrogen sulfide. In addition, functions as scaffolding protein that modulates transcriptional activation by the LEF1/TCF1-CTNNB1 complex and by the complex formed with MITF and CTNNB1. Modulates p53/TP53 levels and p53/TP53-mediated apoptosis. Modulates proteasomal degradation of target proteins by the SCF (SKP2-CUL1-F-box protein) E3 ubiquitin-protein ligase complex (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Hint1 (NM_008248) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MG200661 Hint1 (tGFP-tagged) - Mouse histidine triad nucleotide binding protein 1 (Hint1) 10 ug
$350.00
MR200661L3 Lenti ORF clone of Hint1 (Myc-DDK-tagged) - Mouse histidine triad nucleotide binding protein 1 (Hint1) 10 ug
$450.00
MR200661L4 Lenti ORF clone of Hint1 (mGFP-tagged) - Mouse histidine triad nucleotide binding protein 1 (Hint1) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.