Polr2i (NM_027259) Mouse Tagged ORF Clone

SKU
MR200650
Polr2i (Myc-DDK-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide I (Polr2i)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Polr2i
Synonyms 2810002B19Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR200650 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAACCCGACGGGACGTACGAGCCTGGCTTCGTGGGTATTCGGTTCTGCCAGGAATGTAATAACATGC
TGTACCCCAAGGAGGACAAGGAAAATCGCATTCTGCTGTACGCGTGCCGGAATTGCGATTACCAGCAGGA
AGCCGACAACAGCTGCATCTACGTCAACAAAATCACGCACGAAGTGGACGAGCTGACCCAGATCATCGCA
GACGTGTCCCAGGACCCCACGTTGCCCCGGACGGAGGACCACCCGTGCCAGAAGTGTGGCCACAAGGAGG
CAGTGTTCTTTCAGTCACACAGTGCCCGAGCTGAGGACGCCATGCGCCTGTACTATGTTTGCACTGCCCC
ACACTGCGGCCACCGCTGGACTGAG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR200650 protein sequence
Red=Cloning site Green=Tags(s)

MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITHEVDELTQIIA
DVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCGHRWTE

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_027259
ORF Size 375 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_027259.1, NP_081535.1
RefSeq Size 707 bp
RefSeq ORF 378 bp
Locus ID 69920
UniProt ID P60898
Cytogenetics 7 B1
MW 14.5 kDa
Summary DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB9 is part of the upper jaw surrounding the central large cleft and thought to grab the incoming DNA template (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Polr2i (NM_027259) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC207690 Polr2i (untagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide I (Polr2i), (10ug) 10 ug
$165.00
MG200650 Polr2i (tGFP-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide I (Polr2i) 10 ug
$350.00
MR200650L3 Lenti ORF clone of Polr2i (Myc-DDK-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide I (Polr2i) 10 ug
$450.00
MR200650L4 Lenti ORF clone of Polr2i (mGFP-tagged) - Mouse polymerase (RNA) II (DNA directed) polypeptide I (Polr2i) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.