Snrpd1 (NM_009226) Mouse Tagged ORF Clone

CAT#: MR200559

Reviews ()
Write a review
  • TrueORF®

Snrpd1 (Myc-DDK-tagged) - Mouse small nuclear ribonucleoprotein D1 (Snrpd1)



  "NM_009226" in other vectors (4)

Interest in protein/lysate? Submit request here!

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 68.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Snrpd1 (NM_009226) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Snrpd1
Synonyms AA407109; AL023031; SMD1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR200559 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTCGTGAGATTTTTGATGAAATTGAGTCATGAAACTGTAACCATTGAATTGAAGAATGGGACAC
AAGTCCATGGAACAATCACAGGTGTAGATGTCAGCATGAACACACACCTTAAAGCTGTGAAAATGACCCT
GAAGAACAGAGAACCTGTACAGTTGGAAACATTGAGTATTCGAGGCAATAACATTCGGTATTTTATTCTA
CCAGACAGCTTACCTCTAGATACACTACTTGTGGATGTTGAACCTAAGGTGAAGTCTAAGAAAAGAGAAG
CTGTTGCAGGAAGAGGCCGAGGCCGGGGTAGAGGAAGAGGACGTGGTCGTGGCAGAGGAAGAGGGGGTCC
TAGGCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR200559 protein sequence
Red=Cloning site Green=Tags(s)

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL
PDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_009226
ORF Size 360 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_009226.4, NP_033252.1
RefSeq Size 837 bp
RefSeq ORF 360 bp
Locus ID 20641
UniProt ID P62315
Cytogenetics 18 A1
MW 13.3 kDa
Gene Summary Plays role in pre-mRNA splicing as core component of the SMN-Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through non-specific electrostatic contacts with RNA.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "Snrpd1"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 150.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 135.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Order online and get additional $20 off!
Molbio tools