Snrpd1 (NM_009226) Mouse Tagged ORF Clone

CAT#: MG200559

Snrpd1 (tGFP-tagged) - Mouse small nuclear ribonucleoprotein D1 (Snrpd1)

Product Images

Circular map for MG200559

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: TurboGFP
• Symbol: Snrpd1
• Synonyms: AA407109; AL023031; SMD1
• Vector: pCMV6-AC-GFP
• E. coli Selection: Ampicillin (100 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MG200559 representing NM_009226
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGAAGCTCGTGAGATTTTTGATGAAATTGAGTCATGAAACTGTAACCATTGAATTGAAGAATGGGACAC
  AAGTCCATGGAACAATCACAGGTGTAGATGTCAGCATGAACACACACCTTAAAGCTGTGAAAATGACCCT
  GAAGAACAGAGAACCTGTACAGTTGGAAACATTGAGTATTCGAGGCAATAACATTCGGTATTTTATTCTA
  CCAGACAGCTTACCTCTAGATACACTACTTGTGGATGTTGAACCTAAGGTGAAGTCTAAGAAAAGAGAAG
  CTGTTGCAGGAAGAGGCCGAGGCCGGGGTAGAGGAAGAGGACGTGGTCGTGGCAGAGGAAGAGGGGGTCC
  TAGGCGA
  
  ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
  Protein Sequence

  >MG200559 representing NM_009226
  Red=Cloning site Green=Tags(s)
  
  MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL
  PDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
  
  TRTRPLE - GFP Tag - V
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_009226
• ORF Size: 357 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_009226.4, NP_033252.1
• RefSeq Size: 838 bp
• RefSeq ORF: 360 bp
• Locus ID: 20641
• UniProt ID: P62315
• Cytogenetics: 18 A1
• Gene Summary: Plays role in pre-mRNA splicing as core component of the SMN-Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through non-specific electrostatic contacts with RNA.[UniProtKB/Swiss-Prot Function]