Snrpd1 (NM_009226) Mouse Tagged ORF Clone

SKU
MR200559
Snrpd1 (Myc-DDK-tagged) - Mouse small nuclear ribonucleoprotein D1 (Snrpd1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Snrpd1
Synonyms AA407109; AL023031; SMD1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR200559 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTCGTGAGATTTTTGATGAAATTGAGTCATGAAACTGTAACCATTGAATTGAAGAATGGGACAC
AAGTCCATGGAACAATCACAGGTGTAGATGTCAGCATGAACACACACCTTAAAGCTGTGAAAATGACCCT
GAAGAACAGAGAACCTGTACAGTTGGAAACATTGAGTATTCGAGGCAATAACATTCGGTATTTTATTCTA
CCAGACAGCTTACCTCTAGATACACTACTTGTGGATGTTGAACCTAAGGTGAAGTCTAAGAAAAGAGAAG
CTGTTGCAGGAAGAGGCCGAGGCCGGGGTAGAGGAAGAGGACGTGGTCGTGGCAGAGGAAGAGGGGGTCC
TAGGCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR200559 protein sequence
Red=Cloning site Green=Tags(s)

MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFIL
PDSLPLDTLLVDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_009226
ORF Size 357 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_009226.4, NP_033252.1
RefSeq Size 837 bp
RefSeq ORF 360 bp
Locus ID 20641
UniProt ID P62315
Cytogenetics 18 A1
MW 13.3 kDa
Summary Plays role in pre-mRNA splicing as core component of the SMN-Sm complex that mediates spliceosomal snRNP assembly and as component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Component of both the pre-catalytic spliceosome B complex and activated spliceosome C complexes. Is also a component of the minor U12 spliceosome. May act as a charged protein scaffold to promote snRNP assembly or strengthen snRNP-snRNP interactions through non-specific electrostatic contacts with RNA.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Snrpd1 (NM_009226) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC207402 Snrpd1 (untagged) - Mouse small nuclear ribonucleoprotein D1 (Snrpd1), (10ug) 10 ug
$165.00
MG200559 Snrpd1 (tGFP-tagged) - Mouse small nuclear ribonucleoprotein D1 (Snrpd1) 10 ug
$350.00
MR200559L3 Lenti ORF clone of Snrpd1 (Myc-DDK-tagged) - Mouse small nuclear ribonucleoprotein D1 (Snrpd1) 10 ug
$450.00
MR200559L4 Lenti ORF clone of Snrpd1 (mGFP-tagged) - Mouse small nuclear ribonucleoprotein D1 (Snrpd1) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.