Tcim (NM_026931) Mouse Tagged ORF Clone

SKU
MR200377
1810011O10Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 1810011O10 gene (1810011O10Rik)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Tcim
Synonyms 1110065B09Rik; AW121743; AW321058
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR200377 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAAGCCAAGCCAAGCCATCAAGCCACCAGCATGTCCTCGTCTCTTCGAGTAAGCCCGTCCATCCACG
GCTACCACTTCGACACAGCCGCTCGCAAGAAAGCTGTGGGCAACATCTTTGAGAACATAGACCAGGAGTC
CCTGCAGAGGCTCTTCAGGAACTCCGGAGACAAGAAGGCAGAGGAGCGGGCCAAGATCATTTTTGCCATC
GACCAAGATTTGGAGGAGAAAACTCGAGCCCTCATGGCCCTGAAGAAGAGGACAAAAGACAAGCTTCTTC
AGTTTCTCAAACTGCGGAAATATTCCATCAAGGTACAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR200377 protein sequence
Red=Cloning site Green=Tags(s)

MKAKPSHQATSMSSSLRVSPSIHGYHFDTAARKKAVGNIFENIDQESLQRLFRNSGDKKAEERAKIIFAI
DQDLEEKTRALMALKKRTKDKLLQFLKLRKYSIKVH

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_026931
ORF Size 318 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026931.3
RefSeq Size 1331 bp
RefSeq ORF 321 bp
Locus ID 69068
UniProt ID Q9D915
Cytogenetics 8 A2
MW 12.2 kDa
Summary Seems to be involved in the regulation of cell growth an differentiation, may play different and opposite roles depending on the tissue or cell type. May enhance the WNT-CTNNB1 pathway by relieving antagonistic activity of CBY1. Enhances the proliferation of follicular dendritic cells. Plays a role in the mitogen-activated MAPK2/3 signaling pathway, positively regulates G1-to-S-phase transition of the cell cycle. In endothelial cells, enhances key inflammatory mediators and inflammatory response through the modulation of NF-kappaB transcriptional regulatory activity. Involved in the regulation of heat shock response, seems to play a positive feedback with HSF1 to modulate heat-shock downstream gene expression (By similarity). Plays a role in the regulation of hematopoiesis even if the mechanisms are unknown (PubMed:24937306). In cancers such as thyroid or lung cancer, it has been described as promoter of cell proliferation, G1-to-S-phase transition and inhibitor of apoptosis. However, it negatively regulates self-renewal of liver cancer cells via suppresion of NOTCH2 signaling (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Tcim (NM_026931) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC201192 1810011O10Rik (untagged) - Mouse RIKEN cDNA 1810011O10 gene (1810011O10Rik), (10ug) 10 ug
$150.00
MG200377 1810011O10Rik (tGFP-tagged) - Mouse RIKEN cDNA 1810011O10 gene (1810011O10Rik) 10 ug
$350.00
MR200377L3 Lenti ORF clone of 1810011O10Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 1810011O10 gene (1810011O10Rik) 10 ug
$450.00
MR200377L4 Lenti ORF clone of 1810011O10Rik (mGFP-tagged) - Mouse RIKEN cDNA 1810011O10 gene (1810011O10Rik) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.