Tcim (NM_026931) Mouse Tagged ORF Clone

SKU MR200377

1810011O10Rik (Myc-DDK-tagged) - Mouse RIKEN cDNA 1810011O10 gene (1810011O10Rik)

Product Data

• Type: Mouse Tagged ORF Clone
• Target Symbol: Tcim
• Synonyms: 1110065B09Rik; AW121743; AW321058
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR200377 ORF sequence; Red=Cloning site Blue=ORF Green=Tags(s); ; TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC; GCCGCGATCGCC; ; ATGAAAGCCAAGCCAAGCCATCAAGCCACCAGCATGTCCTCGTCTCTTCGAGTAAGCCCGTCCATCCACG; GCTACCACTTCGACACAGCCGCTCGCAAGAAAGCTGTGGGCAACATCTTTGAGAACATAGACCAGGAGTC; CCTGCAGAGGCTCTTCAGGAACTCCGGAGACAAGAAGGCAGAGGAGCGGGCCAAGATCATTTTTGCCATC; GACCAAGATTTGGAGGAGAAAACTCGAGCCCTCATGGCCCTGAAGAAGAGGACAAAAGACAAGCTTCTTC; AGTTTCTCAAACTGCGGAAATATTCCATCAAGGTACAC; ; ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT; ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR200377 protein sequence; Red=Cloning site Green=Tags(s); ; MKAKPSHQATSMSSSLRVSPSIHGYHFDTAARKKAVGNIFENIDQESLQRLFRNSGDKKAEERAKIIFAI; DQDLEEKTRALMALKKRTKDKLLQFLKLRKYSIKVH; ; myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_026931
• ORF Size: 318 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution Method: 1. Centrifuge at 5,000xg for 5min.; 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.; 3. Close the tube and incubate for 10 minutes at room temperature.; 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.; 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
• Note: Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required.
• Shipping: Ambient

Reference Data

• RefSeq: NM_026931.3
• RefSeq Size: 1331 bp
• RefSeq ORF: 321 bp
• Locus ID: 69068
• UniProt ID: Q9D915
• Cytogenetics: 8 A2
• MW: 12.2 kDa
• Summary: Seems to be involved in the regulation of cell growth an differentiation, may play different and opposite roles depending on the tissue or cell type. May enhance the WNT-CTNNB1 pathway by relieving antagonistic activity of CBY1. Enhances the proliferation of follicular dendritic cells. Plays a role in the mitogen-activated MAPK2/3 signaling pathway, positively regulates G1-to-S-phase transition of the cell cycle. In endothelial cells, enhances key inflammatory mediators and inflammatory response through the modulation of NF-kappaB transcriptional regulatory activity. Involved in the regulation of heat shock response, seems to play a positive feedback with HSF1 to modulate heat-shock downstream gene expression (By similarity). Plays a role in the regulation of hematopoiesis even if the mechanisms are unknown (PubMed:24937306). In cancers such as thyroid or lung cancer, it has been described as promoter of cell proliferation, G1-to-S-phase transition and inhibitor of apoptosis. However, it negatively regulates self-renewal of liver cancer cells via suppresion of NOTCH2 signaling (By similarity).[UniProtKB/Swiss-Prot Function]