Cxcl10 (NM_021274) Mouse Tagged ORF Clone
SKU
MR200291
Cxcl10 (Myc-DDK-tagged) - Mouse chemokine (C-X-C motif) ligand 10 (Cxcl10)
-
TrueORF®
TrueORF®
Expression-ready ORF plasmid with C-terminal tag(s)
Click here to learn more.
Product Data | |
Type | Mouse Tagged ORF Clone |
---|---|
Target Symbol | Cxcl10 |
Synonyms | C7; CRG-2; gIP-10; Ifi10; INP10; IP-10; IP10; mob-1; Scyb10 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
ORF Nucleotide Sequence
>MR200291 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGAACCCAAGTGCTGCCGTCATTTTCTGCCTCATCCTGCTGGGTCTGAGTGGGACTCAAGGGATCCCTC TCGCAAGGACGGTCCGCTGCAACTGCATCCATATCGATGACGGGCCAGTGAGAATGAGGGCCATAGGGAA GCTTGAAATCATCCCTGCGAGCCTATCCTGCCCACGTGTTGAGATCATTGCCACGATGAAAAAGAATGAT GAGCAGAGATGTCTGAATCCGGAATCTAAGACCATCAAGAATTTAATGAAAGCGTTTAGCCAAAAAAGGT CTAAAAGGGCTCCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>MR200291 protein sequence
Red=Cloning site Green=Tags(s) MNPSAAVIFCLILLGLSGTQGIPLARTVRCNCIHIDDGPVRMRAIGKLEIIPASLSCPRVEIIATMKKND EQRCLNPESKTIKNLMKAFSQKRSKRAP myc-FLAG tag |
Restriction Sites |
SgfI-MluI Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | NM_021274 |
ORF Size | 294 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution Method | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Shipping | Ambient |
Reference Data | |
RefSeq | NM_021274.2 |
RefSeq Size | 1120 bp |
RefSeq ORF | 297 bp |
Locus ID | 15945 |
UniProt ID | P17515 |
Cytogenetics | 5 46.57 cM |
MW | 10.8 kDa |
Summary | Pro-inflammatory cytokine that is involved in a wide variety of processes such as chemotaxis, differentiation, and activation of peripheral immune cells, regulation of cell growth, apoptosis and modulation of angiostatic effects (By similarity) (PubMed:28623423). Plays thereby an important role during viral infections by stimulating the activation and migration of immune cells to the infected sites (PubMed:18624292, PubMed:19017990, PubMed:28468883). Mechanistically, binding of CXCL10 to the CXCR3 receptor activates G protein-mediated signaling and results in downstream activation of phospholipase C-dependent pathway, an increase in intracellular calcium production and actin reorganization. In turn, recruitment of activated Th1 lymphocytes occurs at sites of inflammation (By similarity). Activation of the CXCL10/CXCR3 axis plays also an important role in neurons in response to brain injury for activating microglia, the resident macrophage population of the central nervous system, and directing them to the lesion site. This recruitment is an essential element for neuronal reorganization (PubMed:15456824).[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
SKU | Description | Size | Price | |
---|---|---|---|---|
MC207309 | Cxcl10 (untagged) - Mouse chemokine (C-X-C motif) ligand 10 (Cxcl10), (10ug) | 10 ug |
$225.00
|
|
MR200291L1 | Lenti ORF clone of Cxcl10 (Myc-DDK-tagged) - Mouse chemokine (C-X-C motif) ligand 10 (Cxcl10) | 10 ug |
$525.00
|
|
MR200291L2 | Lenti ORF clone of Cxcl10 (mGFP-tagged) - Mouse chemokine (C-X-C motif) ligand 10 (Cxcl10) | 10 ug |
$525.00
|
|
MR200291L3 | Lenti ORF clone of Cxcl10 (Myc-DDK-tagged) - Mouse chemokine (C-X-C motif) ligand 10 (Cxcl10) | 10 ug |
$525.00
|
|
MR200291L4 | Lenti ORF clone of Cxcl10 (mGFP-tagged) - Mouse chemokine (C-X-C motif) ligand 10 (Cxcl10) | 10 ug |
$525.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.