Fcer1g (NM_010185) Mouse Tagged ORF Clone

SKU
MR200193
Fcer1g (Myc-DDK-tagged) - Mouse Fc receptor, IgE, high affinity I, gamma polypeptide (Fcer1g)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Fcer1g
Synonyms AI573376; CD23; Fce1g; FcepsilonRI; FcR-gamma; FcRgamma; FcR[g]; Ly-50
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR200193 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCTCAGCCGTGATCTTGTTCTTGCTCCTTTTGGTGGAACAAGCAGCCGCCCTGGGAGAGCCGCAGC
TCTGCTATATCCTGGATGCTGTCCTGTTTTTGTATGGTATTGTCCTTACCCTACTCTACTGTCGACTCAA
GATCCAGGTCCGAAAGGCAGCTATAGCCAGCCGTGAGAAAGCAGATGCTGTCTACACGGGCCTGAACACC
CGGAGCCAGGAGACATATGAGACTCTGAAGCATGAGAAACCACCCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR200193 protein sequence
Red=Cloning site Green=Tags(s)

MISAVILFLLLLVEQAAALGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREKADAVYTGLNT
RSQETYETLKHEKPPQ

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_010185
ORF Size 258 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010185.4, NP_034315.1
RefSeq Size 683 bp
RefSeq ORF 261 bp
Locus ID 14127
UniProt ID P20491
Cytogenetics 1 79.23 cM
MW 9.7 kDa
Summary Adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors. As a component of the high-affinity immunoglobulin E (IgE) receptor, mediates allergic inflammatory signaling in mast cells (PubMed:14764707). As a constitutive component of interleukin-3 receptor complex, selectively mediates interleukin 4/IL4 production by basophils, priming T-cells toward effector T-helper 2 subset (PubMed:19098920). Associates with pattern recognition receptors CLEC4D and CLEC4E to form a functional signaling complex in myeloid cells. Binding of mycobacterial trehalose 6,6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of ITAM, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes (PubMed:23602766) (Probable). May function cooperatively with other activating receptors. Functionally linked to integrin beta-2/ITGB2-mediated neutrophil activation (PubMed:17086186). Also involved in integrin alpha-2/ITGA2-mediated platelet activation (PubMed:9171347).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Fcer1g (NM_010185) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC201831 Fcer1g (untagged) - Mouse Fc receptor, IgE, high affinity I, gamma polypeptide (Fcer1g), (10ug) 10 ug
$150.00
MC201832 Fcer1g (untagged) - Mouse Fc receptor, IgE, high affinity I, gamma polypeptide (Fcer1g), (10ug) 10 ug
$150.00
MR200193L3 Lenti ORF clone of Fcer1g (Myc-DDK-tagged) - Mouse Fc receptor, IgE, high affinity I, gamma polypeptide (Fcer1g) 10 ug
$450.00
MR200193L4 Lenti ORF clone of Fcer1g (mGFP-tagged) - Mouse Fc receptor, IgE, high affinity I, gamma polypeptide (Fcer1g) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.