Cd3e (NM_007648) Mouse Tagged ORF Clone

SKU
MG227669
Cd3e (tGFP-tagged) - Mouse CD3 antigen epsilon polypeptide (Cd3e), (10ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Cd3e
Synonyms AI504783; CD3; CD3epsilon; T3e
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG227669 representing NM_007648
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGTGGAACACTTTCTGGGGCATCCTGTGCCTCAGCCTCCTAGCTGTTGGCACTTGCCAGGACGATG
CCGAGAACATTGAATACAAAGTCTCCATCTCAGGAACCAGTGTAGAGTTGACGTGCCCTCTAGACAGTGA
CGAGAACTTAAAATGGGAAAAAAATGGCCAAGAGCTGCCTCAGAAGCATGATAAGCACCTGGTGCTCCAG
GATTTCTCGGAAGTCGAGGACAGTGGCTACTACGTCTGCTACACACCAGCCTCAAATAAAAACACGTACT
TGTACCTGAAAGCTCGAGTGTGTGAGTACTGTGTGGAGGTGGACCTGACAGCAGTAGCCATAATCATCAT
TGTTGACATCTGTATCACTCTGGGCTTGCTGATGGTCATTTATTACTGGAGCAAGAATAGGAAGGCCAAG
GCCAAGCCTGTGACCCGAGGAACCGGTGCTGGTAGCAGGCCCAGAGGGCAAAACAAGGAGCGGCCACCAC
CTGTTCCCAACCCAGACTATGAGCCCATCCGCAAAGGCCAGCGGGACCTGTATTCTGGCCTGAATCAGAG
AGCAGTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG227669 representing NM_007648
Red=Cloning site Green=Tags(s)

MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQ
DFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDICITLGLLMVIYYWSKNRKAK
AKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_007648
ORF Size 567 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_007648.5
RefSeq Size 1436 bp
RefSeq ORF 570 bp
Locus ID 12501
UniProt ID P22646
Cytogenetics 9 24.84 cM
Summary Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development (PubMed:19956738, PubMed:24899501). Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Cd3e (NM_007648) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC208245 Cd3e (untagged) - Mouse CD3 antigen, epsilon polypeptide (Cd3e), (10ug) 10 ug
$330.00
MR227669 Cd3e (Myc-DDK-tagged) - Mouse CD3 antigen, epsilon polypeptide (Cd3e) 10 ug
$289.00 MSRP $300.00 MSRP $300.00
MR227669L3 Lenti ORF clone of Cd3e (Myc-DDK-tagged) - Mouse CD3 antigen, epsilon polypeptide (Cd3e) 10 ug
$600.00
MR227669L4 Lenti ORF clone of Cd3e (mGFP-tagged) - Mouse CD3 antigen, epsilon polypeptide (Cd3e) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.