Dtd2 (NM_029545) Mouse Tagged ORF Clone

SKU
MG220756
Dtd2 (tGFP-tagged) - Mouse RIKEN cDNA 6530401N04 gene (6530401N04Rik), (10ug)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Dtd2
Synonyms 4930578F06Rik; 6530401N04Rik; B830049N13Rik
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG220756 representing NM_029545
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGACGGTGGTCGTGTGGCCCAGGCTCGTGCGCTCCTGCAGCAGTGCCTGCACGCTCGCCTGCAAG
TGCGCCCGGCCGATGGAGACGCCGCGGCGCAGTGGGTGGAGATTCGGAGAGGATTGGTGATCTATGTGTG
TTTCTTCAAGGGAGCTGACACAGACCTTCTCCCCAAAATGGTTAATACGCTGTTAAATGTGAAGTTAAGC
GAAACGGAAACCGGCAAGCACGTCTCCATCCTCGATCTGCCTGGCGATGTTCTGATCATCCCGCAAGCCA
CCCTCGGGGGCAGGGTGAAAGGGCGGAGCATGCAGTACCACTCTAACTCTGGAAAGGAGGAGGGCTCAGA
ACTGTACTCCCAGTTTGTGAGTCTGTGTGAAAAAGCCGTGGCCAACAACACCAAGAGTGTAGAAGCGGGG
GTTGCGGTGGCGCACGGCACGTACGGGAACAGGCAAGTGTTAAAGCTGGACACCAATGGACCCTACACGC
ACCTCATTGAGTTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG220756 representing NM_029545
Red=Cloning site Green=Tags(s)

MADGGRVAQARALLQQCLHARLQVRPADGDAAAQWVEIRRGLVIYVCFFKGADTDLLPKMVNTLLNVKLS
ETETGKHVSILDLPGDVLIIPQATLGGRVKGRSMQYHSNSGKEEGSELYSQFVSLCEKAVANNTKSVEAG
VAVAHGTYGNRQVLKLDTNGPYTHLIEF

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_029545
ORF Size 504 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_029545.3
RefSeq Size 2564 bp
RefSeq ORF 507 bp
Locus ID 328092
UniProt ID Q8BHA3
Cytogenetics 12 C1
Summary Deacylates mischarged D-aminoacyl-tRNAs. Probably acts by rejecting L-amino acids from its binding site rather than specific recognition of D-amino acids. Catalyzes the hydrolysis of D-tyrosyl-tRNA(Tyr), has no activity on correctly charged L-tyrosyl-tRNA(Tyr). By recycling D-aminoacyl-tRNA to D-amino acids and free tRNA molecules, this enzyme counteracts the toxicity associated with the formation of D-aminoacyl-tRNA entities in vivo and helps enforce protein L-homochirality. In contrast to DTD1, deacylates L-Ala mischarged on tRNA(Thr)(G4.U69) by alanine-tRNA ligase AARS. Can deacylate L-Ala due to a relaxed specificity for substrate chirality caused by the trans conformation of the Gly-Pro motif in the active site. Also hydrolyzes correctly charged, achiral, glycyl-tRNA(Gly) in vitro, although in vivo EEF1A1/EF-Tu may protect cognate achiral glycyl-tRNA(Gly) from DTD2-mediated deacetylation.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Dtd2 (NM_029545) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC214512 Dtd2 (untagged) - Mouse RIKEN cDNA 6530401N04 gene (6530401N04Rik), (10ug) 10 ug
$330.00
MR220756 Dtd2 (Myc-DDK-tagged) - Mouse RIKEN cDNA 6530401N04 gene (6530401N04Rik) 10 ug
$289.00 MSRP $300.00 MSRP $300.00
MR220756L3 Lenti ORF clone of Dtd2 (Myc-DDK-tagged) - Mouse RIKEN cDNA 6530401N04 gene (6530401N04Rik) 10 ug
$600.00
MR220756L4 Lenti ORF clone of Dtd2 (mGFP-tagged) - Mouse RIKEN cDNA 6530401N04 gene (6530401N04Rik) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.