Sip1 (BC053424) Mouse Tagged ORF Clone

SKU
MG201583
Sip1 (tGFP-tagged) - Mouse survivor of motor neuron protein interacting protein 1 (cDNA clone MGC:59266 IMAGE:6336522)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Sip1
Synonyms Gemin2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201583 representing BC053424
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTATGTATTACTTAATTGTAGGATCGAAGCAGCCCAATGTCCAGATGTTGTGGTAGCCCAGATTGACC
CAAAGAAGTTGAAAAGGAAGCAAAGTGTGAACATTTCTGTTCAGAGATTCAGTCCATTATCATCAAGGTG
GGAGCATGGCAGTATCCAGGCAGGCTTGGCACAGGAGGAACTGAGAGTTCTACATCTTCATCCAAAGGCT
GCTAGTGGAAGACTGACTCCCAGGCAACTAGGCTTTCCGGATGCCAGCCTGCGCCTGAAGGTTACTCTCC
AACACTTCAGTGGCAACAACAACAAGTGGCACATTTTTCAACTGTTCGACAGAGTGTACACAAGCATAGA
AATCACTGGAAATCACAACAGTTGGACAGTAATGTGGCAATGCCAAAATCTGAAGATGAAGAAGGCTGGA
AAAAATTTTGTCTGGGTGAAAGGTTATGTGCTGAAGGGGCCACTGGACCGTCTACAGAGGAAAGCCCTGG
GATCGATTATGTACAAGTTGGTTTTCCTCCTTTGCTTAGTATTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201583 representing BC053424
Red=Cloning site Green=Tags(s)

MYVLLNCRIEAAQCPDVVVAQIDPKKLKRKQSVNISVQRFSPLSSRWEHGSIQAGLAQEELRVLHLHPKA
ASGRLTPRQLGFPDASLRLKVTLQHFSGNNNKWHIFQLFDRVYTSIEITGNHNSWTVMWQCQNLKMKKAG
KNFVWVKGYVLKGPLDRLQRKALGSIMYKLVFLLCLVL

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN BC053424
ORF Size 534 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC053424, AAH53424
RefSeq Size 2064 bp
RefSeq ORF 536 bp
Locus ID 66603
Cytogenetics 12 C1
Summary This gene encodes one of the proteins found in the survival of motor neuron (SMN) complex, which consists of the SMN protein and several gemin proteins. The SMN complex is localized to a subnuclear compartment called gems (gemini of coiled bodies) and is required for assembly of spliceosomal small nuclear ribonucleoproteins (snRNP) and for pre-mRNA splicing. This protein interacts directly with the SMN protein and it is required for formation of the SMN complex. Disruption of this gene in mouse resulted in impaired snRNP assembly, and motor neuron degeneration. [provided by RefSeq, Sep 2015]
Write Your Own Review
You're reviewing:Sip1 (BC053424) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC207094 Sip1 (untagged) - Mouse survivor of motor neuron protein interacting protein 1 (cDNA clone MGC:59266 IMAGE:6336522), (10ug) 10 ug
$330.00
MR201583 Sip1 (Myc-DDK-tagged) - Mouse survivor of motor neuron protein interacting protein 1 (cDNA clone MGC:59266 IMAGE:6336522) 10 ug
$289.00 MSRP $300.00 MSRP $300.00
MR201583L3 Lenti ORF clone of Sip1 (Myc-DDK-tagged) - Mouse survivor of motor neuron protein interacting protein 1 (cDNA clone MGC:59266 IMAGE:6336522) 10 ug
$600.00
MR201583L4 Lenti ORF clone of Sip1 (mGFP-tagged) - Mouse survivor of motor neuron protein interacting protein 1 (cDNA clone MGC:59266 IMAGE:6336522) 10 ug
$600.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.