Rnf11 (NM_013876) Mouse Tagged ORF Clone

SKU
MG201127
Rnf11 (tGFP-tagged) - Mouse ring finger protein 11 (Rnf11)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Rnf11
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201127 representing NM_013876
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGAACTGCCTCAAATCCCCGACTTCGGATGACATCTCCCTGCTTCACGAGTCTCAGTCCGACCGGG
CTAGCTTTGGCGAGGGGACGGAGCCAGATCAGGAGCCGCCGCCGCCATATCAGGAACAAGTTCCTGTTCC
CATCTATCATCCGACACCTAGCCAGACTCGGCTAGCAACTCAGCTGACTGAAGAGGAACAAATTAGAATA
GCTCAAAGAATAGGCCTTATACAGCATCTGCCTAAAGGAGTTTATGACCCTGGAAGAGATGGATCAGAAA
AAAAGATCCGAGAGTGTGTGATCTGTATGATGGACTTTGTTTATGGGGACCCAATTCGATTTCTGCCGTG
CATGCACATCTATCACCTGGACTGTATAGATGACTGGTTGATGAGATCCTTCACGTGCCCCTCCTGCATG
GAGCCAGTGGATGCAGCACTGCTTTCATCCTATGAGACTAAT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201127 representing NM_013876
Red=Cloning site Green=Tags(s)

MGNCLKSPTSDDISLLHESQSDRASFGEGTEPDQEPPPPYQEQVPVPIYHPTPSQTRLATQLTEEEQIRI
AQRIGLIQHLPKGVYDPGRDGSEKKIRECVICMMDFVYGDPIRFLPCMHIYHLDCIDDWLMRSFTCPSCM
EPVDAALLSSYETN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_013876
ORF Size 462 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_013876.3, NP_038904.1
RefSeq Size 2132 bp
RefSeq ORF 465 bp
Locus ID 29864
UniProt ID Q9QYK7
Cytogenetics 4 C7
Summary Essential component of a ubiquitin-editing protein complex, comprising also TNFAIP3, ITCH and TAX1BP1, that ensures the transient nature of inflammatory signaling pathways. Promotes the association of TNFAIP3 to RIPK1 after TNF stimulation. TNFAIP3 deubiquitinates 'Lys-63' polyubiquitin chains on RIPK1 and catalyzes the formation of 'Lys-48'-polyubiquitin chains. This leads to RIPK1 proteasomal degradation and consequently termination of the TNF- or LPS-mediated activation of NF-kappa-B. Recruits STAMBP to the E3 ubiquitin-ligase SMURF2 for ubiquitination, leading to its degradation by the 26S proteasome.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Rnf11 (NM_013876) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC203728 Rnf11 (untagged) - Mouse ring finger protein 11 (Rnf11), (10ug) 10 ug
$150.00
MR201127 Rnf11 (Myc-DDK-tagged) - Mouse ring finger protein 11 (Rnf11) 10 ug
$289.00
MR201127L3 Lenti ORF clone of Rnf11 (Myc-DDK-tagged) - Mouse ring finger protein 11 (Rnf11) 10 ug
$450.00
MR201127L4 Lenti ORF clone of Rnf11 (mGFP-tagged) - Mouse ring finger protein 11 (Rnf11) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.