Mcpt4 (BC026198) Mouse Tagged ORF Clone

SKU
MG201056
Mcpt4 (tGFP-tagged) - Mouse mast cell protease 4 (cDNA clone MGC:41164 IMAGE:1314753)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Mcpt4
Synonyms MMCP-4, MMCP-4A, MMCP-4B
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG201056 representing BC026198
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGGCCCTACTATTCCTTATGGCACTTCTCTTGCCTTCTGGGGCTGGAGCTGAGGAGATTATTGGTG
GTGTTGAGTCTAGACCACATTCTCGCCCTTACATGGCCCATCTGGAGATCACCACTGAGAGAGGGTTCAC
AGCTACCTGTGGTGGGTTTCTCATAACCCGCCAATTTGTGTTGACTGCTGCACACTGTAGTGGAAGAGAA
ATCACTGTCACCCTTGGAGCTCATGATGTGAGCAAGACAGAATCCACACAGCAGAAGATAAAAGTAGAAA
AACAAATCGTTCACCCAAAGTACAACTTCTATTCCAATCTCCATGACATCATGTTGCTGAAGCTTCAAAA
GAAAGCCAAAGAGACTCCCTCTGTGAATGTAATTCCTCTGCCTCGTCCTTCTGACTTTATCAAGCCGGGG
AAGATGTGCCAGCCTGCCCCCAAGATGATC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG201056 representing BC026198
Red=Cloning site Green=Tags(s)

MQALLFLMALLLPSGAGAEEIIGGVESRPHSRPYMAHLEITTERGFTATCGGFLITRQFVLTAAHCSGRE
ITVTLGAHDVSKTESTQQKIKVEKQIVHPKYNFYSNLHDIMLLKLQKKAKETPSVNVIPLPRPSDFIKPG
KMCQPAPKMI

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN BC026198
ORF Size 450 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq BC026198, AAH26198
RefSeq Size 554 bp
RefSeq ORF 452 bp
Locus ID 17227
Cytogenetics 14 28.19 cM
Summary Has chymotrypsin-like activity. Hydrolyzes the amide bonds of synthetic substrates having Tyr and Phe residues at the P1 position. Preferentially hydrolyzes the 'Tyr-4-|-Ile-5' bond of angiotensin I and the 'Phe-20-|-Ala-21' bond of amyloid beta-protein, and is less active towards the 'Phe-8-|-His-9' bond of angiotensin I and the 'Phe-4-|-Ala-5' and 'Tyr-10-|-Glu-11' bonds of amyloid beta-protein. Involved in thrombin regulation and fibronectin processing.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Mcpt4 (BC026198) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC206841 Mcpt4 (untagged) - Mouse mast cell protease 4 (cDNA clone MGC:41164 IMAGE:1314753), (10ug) 10 ug
$165.00
MR201056 Mcpt4 (Myc-DDK-tagged) - Mouse mast cell protease 4 (cDNA clone MGC:41164 IMAGE:1314753) 10 ug
$289.00
MR201056L3 Lenti ORF clone of Mcpt4 (Myc-DDK-tagged) - Mouse mast cell protease 4 (cDNA clone MGC:41164 IMAGE:1314753) 10 ug
$450.00
MR201056L4 Lenti ORF clone of Mcpt4 (mGFP-tagged) - Mouse mast cell protease 4 (cDNA clone MGC:41164 IMAGE:1314753) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.