Nhlh1 (NM_010916) Mouse Tagged ORF Clone

SKU
MG200773
Nhlh1 (tGFP-tagged) - Mouse nescient helix loop helix 1 (Nhlh1)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Nhlh1
Synonyms bHLHa35; Hen1; Nscl; Tal2
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200773 representing NM_010916
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGCTCAACTCCGATACCATGGAGCTGGACCTGCCTCCCACCCACTCGGAGACCGAGTCGGGCTTTA
GCGACTGTGGGGGCGGACCGGGCCCCGATGGTGCTGGATCCGGGGATCCAGGAGTGGTCCAGGTCCGGAG
CTCAGAGCTTGGAGAGTCCGGCCGCAAAGACCTGCAGCACTTGAGTCGTGAGGAGCGCAGGCGCCGGCGC
CGCGCCACGGCCAAGTACCGCACGGCACACGCCACGCGGGAGCGCATCCGCGTGGAAGCCTTCAACCTAG
CCTTCGCCGAGCTGCGCAAGCTGCTGCCCACTCTGCCCCCGGACAAGAAGCTCTCTAAGATTGAGATCCT
ACGCCTGGCCATCTGCTATATCTCCTACCTGAACCATGTGCTGGACGTC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200773 representing NM_010916
Red=Cloning site Green=Tags(s)

MMLNSDTMELDLPPTHSETESGFSDCGGGPGPDGAGSGDPGVVQVRSSELGESGRKDLQHLSREERRRRR
RATAKYRTAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_010916
ORF Size 399 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010916.2, NP_035046.1
RefSeq Size 2458 bp
RefSeq ORF 402 bp
Locus ID 18071
UniProt ID Q02576
Cytogenetics 1 79.54 cM
Summary May serve as DNA-binding protein and may be involved in the control of cell-type determination, possibly within the developing nervous system.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Nhlh1 (NM_010916) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC207334 Nhlh1 (untagged) - Mouse nescient helix loop helix 1 (Nhlh1), (10ug) 10 ug
$165.00
MR200773 Nhlh1 (Myc-DDK-tagged) - Mouse nescient helix loop helix 1 (Nhlh1) 10 ug
$289.00
MR200773L3 Lenti ORF clone of Nhlh1 (Myc-DDK-tagged) - Mouse nescient helix loop helix 1 (Nhlh1) 10 ug
$450.00
MR200773L4 Lenti ORF clone of Nhlh1 (mGFP-tagged) - Mouse nescient helix loop helix 1 (Nhlh1) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.