Map1lc3b (NM_026160) Mouse Tagged ORF Clone

SKU
MG200654
Map1lc3b (tGFP-tagged) - Mouse microtubule-associated protein 1 light chain 3 beta (Map1lc3b)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$489.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Map1lc3b
Synonyms 1010001C15Rik; Atg8; LC3b; Map1lc3
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200654 representing NM_026160
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGTCCGAGAAGACCTTCAAGCAGCGCCGGAGCTTTGAACAAAGAGTGGAAGATGTCCGGCTCATCC
GGGAGCAGCACCCCACCAAGATCCCAGTGATTATAGAGCGATACAAGGGGGAGAAGCAGCTGCCCGTCCT
GGACAAGACCAAGTTCCTGGTGCCTGACCACGTGAACATGAGCGAGCTCATCAAGATAATCAGACGGCGC
TTGCAGCTCAATGCTAACCAAGCCTTCTTCCTCCTGGTGAATGGGCACAGCATGGTGAGTGTGTCCACTC
CCATCTCCGAAGTGTACGAGAGTGAGAGAGATGAAGACGGCTTCCTGTACATGGTTTATGCCTCGCAGGA
GACATTCGGGACAGCAATGGCTGTG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200654 representing NM_026160
Red=Cloning site Green=Tags(s)

MPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRR
LQLNANQAFFLLVNGHSMVSVSTPISEVYESERDEDGFLYMVYASQETFGTAMAV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_026160
ORF Size 375 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_026160.5
RefSeq Size 1711 bp
RefSeq ORF 378 bp
Locus ID 67443
UniProt ID Q9CQV6
Cytogenetics 8 E1
Summary Ubiquitin-like modifier involved in formation of autophagosomal vacuoles (autophagosomes). Plays a role in mitophagy which contributes to regulate mitochondrial quantity and quality by eliminating the mitochondria to a basal level to fulfill cellular energy requirements and preventing excess ROS production. Whereas LC3s are involved in elongation of the phagophore membrane, the GABARAP/GATE-16 subfamily is essential for a later stage in autophagosome maturation. Promotes primary ciliogenesis by removing OFD1 from centriolar satellites via the autophagic pathway.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Map1lc3b (NM_026160) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC203443 Map1lc3b (untagged) - Mouse microtubule-associated protein 1 light chain 3 beta (Map1lc3b), (10ug) 10 ug
$150.00
MR200654 Map1lc3b (Myc-DDK-tagged) - Mouse microtubule-associated protein 1 light chain 3 beta (Map1lc3b) 10 ug
$289.00
MR200654L3 Lenti ORF clone of Map1lc3b (Myc-DDK-tagged) - Mouse microtubule-associated protein 1 light chain 3 beta (Map1lc3b) 10 ug
$450.00
MR200654L4 Lenti ORF clone of Map1lc3b (mGFP-tagged) - Mouse microtubule-associated protein 1 light chain 3 beta (Map1lc3b) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.