Anapc13 (NM_181394) Mouse Tagged ORF Clone

SKU
MG200095
Anapc13 (tGFP-tagged) - Mouse anaphase promoting complex subunit 13 (Anapc13)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$350.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Anapc13
Synonyms 1810004D07Rik; APC13; SWM1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MG200095 representing NM_181394
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACAGTGAGGTACAGCGAGATGGAAGGATCTTGGACCTGATTGATGATGCTTGGCGGGAAGATAAGC
TGCCATATGAGGATGTCGCCATTCCACTGAGTGAGCTTCCTGAGCCCGAGCAAGACAACGGAGGCACCAC
AGAGTCTGTGAAAGAACAGGAGATGAAGTGGACAGACCTGGCCTTACAGGGCCTCCACGAGAACGTCCCA
CCCGCTGGAAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>MG200095 representing NM_181394
Red=Cloning site Green=Tags(s)

MDSEVQRDGRILDLIDDAWREDKLPYEDVAIPLSELPEPEQDNGGTTESVKEQEMKWTDLALQGLHENVP
PAGN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_181394
ORF Size 222 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_181394.3
RefSeq Size 384 bp
RefSeq ORF 225 bp
Locus ID 69010
UniProt ID Q8R034
Cytogenetics 9 F1
Summary Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin ligase that controls progression through mitosis and the G1 phase of the cell cycle. The APC/C complex acts by mediating ubiquitination and subsequent degradation of target proteins: it mainly mediates the formation of 'Lys-11'-linked polyubiquitin chains and, to a lower extent, the formation of 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Anapc13 (NM_181394) Mouse Tagged ORF Clone
Your Rating
SKU Description Size Price
MC204684 Anapc13 (untagged) - Mouse anaphase promoting complex subunit 13 (Anapc13), (10ug) 10 ug
$150.00
MR200095 Anapc13 (Myc-DDK-tagged) - Mouse anaphase promoting complex subunit 13 (Anapc13) 10 ug
$289.00
MR200095L3 Lenti ORF clone of Anapc13 (Myc-DDK-tagged) - Mouse anaphase promoting complex subunit 13 (Anapc13) 10 ug
$450.00
MR200095L4 Lenti ORF clone of Anapc13 (mGFP-tagged) - Mouse anaphase promoting complex subunit 13 (Anapc13) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.