EMA (MUC1) Rabbit Polyclonal Antibody

SKU TA336810

Rabbit Polyclonal MUC-1 Antibody

Product Data

• Application: FC, ICC/IF, IHC, WB
• Recommended Dilution: Knockout Validated, Western Blot: 0.2-1 ug/ml, Immunocytochemistry/ Immunofluorescence: 1:10-1:500, Immunohistochemistry: 1:10-1:500, Flow Cytometry, Immunohistochemistry-Paraffin: 4-8 ug/ml
• Reactivity: Bovine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat
• Antibody Host: Rabbit
• Clonality: Polyclonal
• Immunogen: Synthetic peptides corresponding to MUC1(mucin 1, cell surface associated) The peptide sequence was selected from the C terminal region between aa 1200-1250 of human MUC1 (NP_001037855). Peptide sequence GQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSL.
• Buffer: PBS, 0.02% Sodium Azide. Store at -20C. Avoid freeze-thaw cycles.
• Concentration: lot specific
• Purification: Affinity purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 122 kDa.; Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Gene Name: mucin 1, cell surface associated
• Database Link:
  NP_002447
  P15941
• Background: MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.
• Synonyms: ADMCKD; ADMCKD1; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; SEC

Reference Data

• Protein Families: Druggable Genome, Secreted Protein, Transmembrane