Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | ChIP, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221] |
Rabbit Polyclonal Antibody against Eg5
| Applications | ICC/IF, Immunoblotting, IP, WB |
| Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Produced by immunization of rabbits with a recombinant segment of the coiled-coil domain of the human protein. |
Goat IgG (H+L chain) rabbit polyclonal antibody, HRP
| Applications | ELISA: 1/50,000-1/100,000. Western Blot: 1/5,000-1/20,000. Immunohistochemistry: 1/1,000-1/5,000. Note: HRP Secondary antibody reagents are available in a variety of formats and conjugate types. When choosing a secondary antibody product, consideration must be given to species and immunoglobulin specificity, conjugate type, fragment and chain specificity, level of cross-reactivity, and host-species source and fragment composition. |
| Reactivities | Goat |
| Conjugation | HRP |
| Immunogen | Goat IgG whole molecule. |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Bovine, Deer, Goat, Human, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Bovine Luteinizing Hormone |
Rabbit Polyclonal Antibody against TPX2
| Applications | FC, ICC/IF, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Produced by immunizing rabbits with a recombinant segment of the C-terminal domain of the human protein |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Bovine, Dog, Xenopus, Gorilla, Goat, Human, Monkey, Pig, Rabbit, Rat, Gibbon, Hamster, Horse, Orang-Utan (Predicted: Mouse, Bat, Zebrafish, Guinea Pig) |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
Recombinant Anti-CD44 (Clone Hermes-1)
| Applications | Bl, ELISA, FC, IF, IHC, IP, Neutralize, WB |
| Reactivities | Human, Mouse, Rat, Goat, Primate, Rabbit, Sheep, Bovine |
| Conjugation | Unconjugated |
Rabbit Polyclonal DGAT1 Antibody
| Applications | ICC/IF, Immunoblotting, WB |
| Reactivities | Bovine, Goat, Human, Mouse, Primate, Rat, Sheep, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide within an internal region (residues 200-300) of the human DGAT1 protein. [Swiss-Prot# O75907] |
Desmin (DES) rabbit polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Canine, Chicken, Goat, Hamster, Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Chicken gizzard muscle Desmin. Desmin was purified from a crude tissue preparation by preparative gel electrophoresis as described in Reference 1. |
Goat IgG (H+L chain) rabbit polyclonal antibody, AP
| Applications | Suitable for Immunoblotting (Western or Dot blot), ELISA and Immunohistochemistry as well as other phosphatase-antibody based enzymatic assays requiring lot-to-lot consistency. Recommended Dilutions: ELISA: 1/2,000-1/13,000. Western blot: 1/500-1/2,500. Immunohistochemistry: 1/200-1/1,000. |
| Reactivities | Goat |
| Conjugation | AP |
| Immunogen | Goat IgG whole molecule. |
Germany
Japan
United Kingdom
China
