RHOC Rabbit Polyclonal Antibody

CAT#: TA333447

Rabbit Polyclonal Anti-RHOC Antibody

Product Images

WB Suggested Anti-RHOC Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Liver

• 

  Lanes: Lane 1: 20ug of Brugia malayi total worm extract; Primary Antibody Dilution: 1:1000; Secondary Antibody: Anti-rabbit-HRP; Secondary Antibody Dilution: ; 1:5000; Gene Name: ; RHOC; Submitted by: ; Peter U. Fischer, Washington University School of Me

• 

  Sample Type : Brugia malayi intestinal cross sectionPrimary Antibody Dilution : 1:200Secondary Antibody : Anti-rabbit-APSecondary Antibody Dilution :; 1:5000Gene Name :; RHOCSubmitted by :; Peter U. Fischer, Ph.D., Research Associate Professor, Washington

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 22 kDa
• Gene Name: ras homolog family member C
• Database Link:
  NP_786886
  Entrez Gene 11853 MouseEntrez Gene 295342 RatEntrez Gene 389 Human
  UniProt ID P08134
• Background: RHOC Is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. RHOC is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of RHOC is associated with tumor cell proliferation and metastasis.This gene encodes a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. The protein encoded by this gene is prenylated at its C-terminus, and localizes to the cytoplasm and plasma membrane. It is thought to be important in cell locomotion. Overexpression of this gene is associated with tumor cell proliferation and metastasis. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Synonyms: ARH9; ARHC; H9; RHOH9
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome