Iba1 (149-161) goat polyclonal antibody, Purified from goat serum by ammonium sulphate precipitation followed by antigen affinity chromatography using the immunizing peptide.
| Applications | ELISA, IHC, WB |
| Reactivities | Hamster, Human, Monkey, Mouse, Porcine, Rat, Bovine, Equine, Goat, Rabbit, Pig |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TGPPAKKAISELP, from the C-Terminus of protein sequence according to NP_116573.1NP_001614.3. |
Rabbit Polyclonal HIF-1 alpha Antibody
| Applications | ChIP, FC, ICC/IF, IHC, Immunoblotting, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate |
| Conjugation | Unconjugated |
| Immunogen | A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221] |
Rabbit Polyclonal Antibody against Eg5
| Applications | ICC/IF, Immunoblotting, IP, WB |
| Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Produced by immunization of rabbits with a recombinant segment of the coiled-coil domain of the human protein. |
Luteinizing Hormone beta (LHB) rabbit polyclonal antibody, Serum
| Applications | ELISA, IHC, R, WB |
| Reactivities | Bovine, Deer, Goat, Human, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Bovine Luteinizing Hormone |
Rabbit Polyclonal Antibody against TPX2
| Applications | FC, ICC/IF, IP, Simple Western, WB |
| Reactivities | Human, Mouse, Bovine, Goat, Hamster, Sheep |
| Conjugation | Unconjugated |
| Immunogen | Produced by immunizing rabbits with a recombinant segment of the C-terminal domain of the human protein |
Rabbit Polyclonal Anti-RHOC Antibody
| Applications | IHC, WB |
| Reactivities | Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF |
Rabbit Polyclonal DGAT1 Antibody
| Applications | ICC/IF, Immunoblotting, WB |
| Reactivities | Bovine, Goat, Human, Mouse, Primate, Rat, Sheep, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide within an internal region (residues 200-300) of the human DGAT1 protein. [Swiss-Prot# O75907] |
DKK1 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Bovine, Canine, Equine, Goat, Monkey, Mouse, Porcine |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide from the C-terminus of human DKK1 (NP_036374.1) |
Desmin (DES) rabbit polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Canine, Chicken, Goat, Hamster, Human, Mouse, Rat, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | Chicken gizzard muscle Desmin. Desmin was purified from a crude tissue preparation by preparative gel electrophoresis as described in Reference 1. |
CXCL10 Antibody
| Applications | ELISA, WB |
| Reactivities | Goat |
| Conjugation | Unconjugated |
| Immunogen | This protein-A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein raised in yeast, corresponding to the 83 amino acids of the mature bovine CXCL10 protein. |
CXCL10 Antibody
| Applications | ELISA, WB |
| Reactivities | Goat |
| Conjugation | Unconjugated |
| Immunogen | This protein-A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein raised in yeast, corresponding to the 83 amino acids of the mature bovine CXCL10 protein. |
Germany
Japan
United Kingdom
China
