Antibodies

View as table Download

Goat Polyclonal Anti-ZO1 Antibody

Applications IF, IHC, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 1580 aa to the C-terminus of human ZO-1 produced in E. coli.

Rabbit Anti-Collagen 1, alpha 1 propeptide Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues specific to the collagen 1, alpha 1 propeptide conjugated to KLH

Goat Polyclonal Anti-CANX Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide within residues 550 aa to the C-terminus of human CANX produced in E. coli.

Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control

Applications ICC/IF, IHC, Simple Western, WB
Reactivities Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437.

Goat Polyclonal Anti-CD63 Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 120 aa to 175 aa of human CD63 produced in E. coli.

Goat Polyclonal Antibody against ABCC4

Applications IHC, WB
Reactivities Human, Rat (Expected from sequence similarity: Mouse)
Conjugation Unconjugated
Immunogen Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2.

Rabbit Polyclonal Antibody against XCT

Applications FC, ICC/IF, IHC, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a region within the N-terminus of the human XCT protein sequence (between residues 1-50).

Rabbit Polyclonal VLK Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK.

Rabbit Polyclonal Nephrin Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Nephrin antibody was raised against a 14 amino acid synthetic peptide from near the carboxy terminus of human Nephrin. The immunogen is located within the last 50 amino acids of Nephrin.

Anti-FOXO1 (Phospho-Ser256) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of serine 256 (A-A-S(p)-M-D) derived from Human FKHR.
Modifications Phospho-specific

Rabbit polyclonal RELA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH derived from within residues 100 - 170 of Human RELA.

ABCC4 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC4

Rabbit polyclonal anti-Cox2 (PTGS2) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cox2.

Rabbit Polyclonal PCNA Antibody

Applications ELISA, IHC, WB
Reactivities Human, Dog, Rat, Monkey, Mouse
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal Anti-ISG15 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK