ISG15 Rabbit Polyclonal Antibody

SKU TA342596

Rabbit Polyclonal Anti-ISG15 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 17 kDa
• Gene Name: ISG15 ubiquitin-like modifier
• Database Link:
  NP_005092
  P05161
• Background: ISG15 is a ubiquitin-like protein that becomes conjugated to many cellular proteins upon activation by interferon-alpha.
• Synonyms: G1P2; hUCRP; IFI15; IMD38; IP17; UCRP
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Goat: 86%; Horse: 86%; Sheep: 86%; Bovine: 86%; Pig: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Secreted Protein
• Protein Pathways: RIG-I-like receptor signaling pathway