Antibodies

View as table Download

Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)

Applications IF, IHC, WB
Reactivities Human (Predicted: Bovine, Dog, Pig, Rabbit, Guinea Pig, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348)

Rabbit polyclonal antibody to NQO1 (NAD(P)H dehydrogenase, quinone 1)

Applications IF, IHC, WB
Reactivities Human (Predicted: Pig, Bovine, Guinea Pig, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 213 and 274 of NQO1 (Uniprot ID#P15559)

Rabbit Polyclonal antibody to beta Actin (actin, beta)

Applications IF, IHC, WB
Reactivities Human (Predicted: Rat, Dog, Rabbit, Chicken, Sheep, Chimpanzee, Bovine, Guinea Pig, Rhesus Monkey, Mouse)
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 309 and 358 of beta Actin

Mouse monoclonal Hsp70 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Carp, Monkey, Pig, Rabbit, Sheep, Hamster, Guinea Pig, C. elegans, Drosophila
Conjugation Unconjugated

Rabbit Polyclonal Anti-RHOC Antibody

Applications IHC, WB
Reactivities Human, Cow, Dog, Goat, Guinea Pig, Horse, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish, Brugia malayi
Conjugation Unconjugated
Immunogen The immunogen for Anti-RHOC Antibody: synthetic peptide directed towards the N terminal of human RHOC. Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF

Rabbit polyclonal antibody to GIRK1 (potassium inwardly-rectifying channel, subfamily J, member 3)

Applications IHC, WB
Reactivities Human (Predicted: Guinea Pig, Rhesus Monkey)
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 248 and 501 of GIRK1 (Uniprot ID#P48549)

Rabbit polyclonal antibody to Histamine H3 Receptor (histamine receptor H3)

Applications IHC, WB
Reactivities Human (Predicted: Rat, Rabbit, Guinea Pig, Rhesus Monkey, Mouse)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 293 and 387 of Histamine H3 Receptor (Uniprot ID#Q9Y5N1)

Rabbit anti Actin, skeletal muscle Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Rat, Rabbit, Guinea Pig
Conjugation Unconjugated
Immunogen A synthetic peptide derived from N-terminus of human alpha skeletal muscle isoforms of actin. This sequence is identical in human, rat, mouse, dog, bovine, guinea pig, sheep and frog origins.

Rabbit Polyclonal Antibody against VEGFA

Applications ELISA, WB
Reactivities Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692]

Rabbit Anti-DOPA Decarboxylase, Human Antibody

Applications WB
Reactivities Bovine, Dog, Human, Rabbit, Rat, Sheep, Guinea Pig
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH

C3 goat polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, WB
Reactivities Guinea Pig
Conjugation Biotin
Immunogen C3c is isolated and purified from pooled normal guinea pig serum. Freund’s complete adjuvant is used in the first step of the immunization procedure.

C3 goat polyclonal antibody, FITC

Applications ELISA, ID, IF, IP, WB
Reactivities Guinea Pig
Conjugation FITC
Immunogen C3c is isolated and purified from pooled normal guinea pig serum. Freund’s complete adjuvant is used in the first step of the immunization procedure.

C3 goat polyclonal antibody, HRP

Applications ELISA, ID, IF, IP, WB
Reactivities Guinea Pig
Conjugation HRP
Immunogen C3c is isolated and purified from pooled normal guinea pig serum. Freund’s complete adjuvant is used in the first step of the immunization procedure.

Rabbit polyclonal antibody to RAMP1 (receptor (G protein-coupled) activity modifying protein 1)

Applications WB
Reactivities Human (Predicted: Mouse, Rat, Pig, Guinea Pig, X. tropicalis)
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 84 and 148 of RAMP1 (Uniprot ID#O60894)

Rabbit Polyclonal Anti-FAM86A Antibody

Applications WB
Reactivities Human (Predicted: Rat, Dog, Cow, Guinea Pig, Horse)
Conjugation Unconjugated
Immunogen The immunogen for Anti-FAM86A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM86A. Synthetic peptide located within the following region: CREHQRAPEVYVAFTVRNPETCQLFTTELGRAGIRWEVEPRHEQKLFPYE