Mnat1 (NM_008612) Mouse Recombinant Protein

SKU TP527103

Purified recombinant protein of Mouse menage a trois 1 (Mnat1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR227103 representing NM_008612; Red=Cloning site Green=Tags(s); ; MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRVQLFEDPTVDK; EVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLENTKKKMEIYQKENKDVIQKNKLKL; TREQEELEEALEVERQEHEQRRLFIQKEEELQQALKRKNKQAFLDELESSDLPVALLLAQHKDRSTQLEM; QLEKPRSMKPVTFSTGIKMGQQISLAPIQKLEEALYEYQPLQIETCGPQVPEQELLGRLGYLNHVRAASP; QDLAGGYTSSLACHRALQDAFSGLFWQPR; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 36.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_032638
• Locus ID: 17420
• UniProt ID: P51949
• Cytogenetics: 12 C3
• RefSeq Size: 2505
• RefSeq ORF: 927
• Synonyms: E130115E11Rik; MAT1; P36
• Summary: Stabilizes the cyclin H-CDK7 complex to form a functional CDK-activating kinase (CAK) enzymatic complex. CAK activates the cyclin-associated kinases CDK1, CDK2, CDK4 and CDK6 by threonine phosphorylation. CAK complexed to the core-TFIIH basal transcription factor activates RNA polymerase II by serine phosphorylation of the repetitive C-terminal domain (CTD) of its large subunit (POLR2A), allowing its escape from the promoter and elongation of the transcripts. Involved in cell cycle control and in RNA transcription by RNA polymerase II.[UniProtKB/Swiss-Prot Function]