Tfcp2l1 (NM_023755) Mouse Recombinant Protein

SKU TP526633

Purified recombinant protein of Mouse transcription factor CP2-like 1 (Tfcp2l1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR226633 protein sequence; Red=Cloning site Green=Tags(s); ; MLFWHTQPEHYNQHNSGSYLRDVLALPIFKQEEPQLSPENGARLPPLQYVLCAATSPAVKLHEETLTYLN; QGQSYEIRLLENRKLGDFQDLNTKYVKSIIRVVFHDRRLQYTEYQQLEGWRWSRPGDRILDIDIPLSVGI; LDPRASPTQLNAVEFLWDPSKRASAFIQVHCISTEFTPRKHGGEKGVPFRVQIDTFKQNESGDYSEHLHS; ASCQIKVFKPKGADRKQKTDREKMEKRTAQEKEKYQPSYETTILTECSPWPDVPYQANNTPSPSYNGSPN; SFGLREGNSSPNHPVEPLPLGSDHLLPSASIQDAQQWLHRNRFSQFCWLFASFSGADLLKMSRDDLVQVC; GPADGIRLFNAIKGRNVRPKMTIYVCQELEQNQLPLPQKQDDSGDNSLCVYHAIFLEELTTLELTEKIAS; LYSIPPQHIHRVYRQGPAGIHVVVSNEMVQNFQDESCFILSTLKAESNDGYHIILKCGL; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 54.7 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_076244
• Locus ID: 81879
• UniProt ID: Q3UNW5
• Cytogenetics: 1 E2.3
• RefSeq Size: 9285
• RefSeq ORF: 1437
• Synonyms: 1810030F05Rik; 4932442M07Rik; AA575098; Cp2l1; Crtr-1; D930018N21Rik; LBP-9; Tcfcp2l1
• Summary: Transcription factor that facilitates establishment and maintenance of pluripotency in embryonic stem cells (ESCs) (PubMed:23942233, PubMed:26321140). With Klf2, acts as the major effector of self-renewal that mediates induction of pluripotency downstream of LIF/Stat3 and Wnt/beta-catenin signaling (PubMed:23942238, PubMed:23942233, PubMed:26321140). Required for normal duct development in the salivary gland and kidney (PubMed:17079272). Coordinates the development of the kidney collecting ducts intercalated (IC) and principal (PC) cells, which regulate acid-base and salt-water homeostasis, respectively (PubMed:28577314). Regulates the expression of IC genes including subunits B1 and D2 of the V-ATPase complex, Oxgr1, Ca12, Slc4a1, Aqp6 and IC-specific transcription factor Foxi1 (PubMed:28577314). Regulates also the expression of Jag1 and subsequent notch signaling in the collecting duct (PubMed:28577314). Jag1 initiates notch signaling in PCs but inhibits notch signaling in ICs (PubMed:28577314). Acts as a transcriptional suppressor that may suppress UBP1-mediated transcriptional activation (PubMed:11073954). Modulates the placental expression of CYP11A1 (By similarity).[UniProtKB/Swiss-Prot Function]