B4galt5 (NM_019835) Mouse Recombinant Protein
SKU
TP525689
Purified recombinant protein of Mouse UDP-Gal:betaGlcNAc beta 1,4-galactosyltransferase, polypeptide 5 (B4galt5), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Mouse |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>MR225689 representing NM_019835
Red=Cloning site Green=Tags(s) MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMVQAQGILLRDNVRTIGAQVYEQVVR SAYAKRNSSLNDSDYPLDLNHSEAFPPTTTFLPEDFTYFANHPCPERLPSMKGPIDINMSEIAMDDIHEL FSRDPAIKLGGHWKPADCVPRWKVAILIPFRNRHEHLPVLLRHLLPMLQRQRLQFAFYVIEQVGTQPFNR AMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTV EQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKER QGLDGLNNLNYSANVTYDALYKNITVNLTPELAQVTEY myc-FLAG tag |
Tag | Myc-DDK |
Predicted MW | 45.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_062809 |
Locus ID | 56336 |
UniProt ID | Q9JMK0 |
Cytogenetics | 2 H3 |
RefSeq Size | 4205 |
RefSeq ORF | 1164 |
Synonyms | 9430078I07Rik; AW049941; AW539721 |
Summary | Catalyzes the synthesis of lactosylceramide (LacCer) via the transfer of galactose from UDP-galactose to glucosylceramide (GlcCer) (PubMed:21057870, PubMed:23882130, PubMed:30114188). LacCer is the starting point in the biosynthesis of all gangliosides (membrane-bound glycosphingolipids) which play pivotal roles in the CNS including neuronal maturation and axonal and myelin formation (PubMed:30114188). Plays a role in the glycosylation of BMPR1A and regulation of its protein stability (PubMed:29415997). Essential for extraembryonic development during early embryogenesis (PubMed:20574042, PubMed:21057870).[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.