Tfb2m (NM_008249) Mouse Recombinant Protein

SKU
TP524455
Purified recombinant protein of Mouse transcription factor B2, mitochondrial (Tfb2m), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR224455 representing NM_008249
Red=Cloning site Green=Tags(s)

MRGPAMRLPPRIALSALARGPSCILGSGAATRKDWQTRNRRGFSDFNIEPLPDSDLEESSPWTSRNRSEP
TRHIACKKAARNLVRDLLEHQNPSRQIILECNPGPGILTGALLKAGARVVAFESEKTFIPHLEPLQRNMD
GELQVVHCDFFKMDPRYQEVVRPDVSSQAIFQNLGIKAVPWSAGVPIKVFGILPYKHERRILWKILFDLY
SCESIYRYGRVELNMFVSEKEFRKLIATPKRPDLYQVMAVLWQVACDVKFLHMEPWSSFSVHTENGHLEK
SKHGESVNLLKQNLYLVRMTPRRTLFTENLSPLNYDIFFHLVKHCFGKRNAPIIRHLRSLSTVDPINILR
QIRKNPGDTAARMYPHDFKKLFETIEQSEDSVFKWIYDYCPEDMEF

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 46.3 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_032275
Locus ID 15278
UniProt ID Q3TL26
Cytogenetics 1 83.56 cM
RefSeq Size 2448
RefSeq ORF 1188
Synonyms Hkp1
Summary S-adenosyl-L-methionine-dependent methyltransferase which specifically dimethylates mitochondrial 12S rRNA at the conserved stem loop. Also required for basal transcription of mitochondrial DNA, probably via its interaction with POLRMT and TFAM. Stimulates transcription independently of the methyltransferase activity.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Tfb2m (NM_008249) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.