Malt1 (NM_172833) Mouse Recombinant Protein

SKU
TP524110
Purified recombinant protein of Mouse mucosa associated lymphoid tissue lymphoma translocation gene 1 (Malt1), full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR224110 representing NM_172833
Red=Cloning site Green=Tags(s)

MSLWGQPLQASPPLAVRQPPTASSGPSTSPPAGATLNRLPEPLLRRLSESLDRAPEGRGWRQLAELAGSR
GRLRLSGLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQALEHTEVLPLLNPPGLKITVNPE
SKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPYGNSSELVFNTVHVKDAGFYVCRVNNSSTFEFSQWS
QLDVCDVAEVTDSFQGSMDGISESRLQICVEPRSQRLVPGSMLLLQCVAIGSPMPHYQWFKDESPLTHET
KKHYTVPYVDIEHEGTYWCHVYNDRDSQDSKKAEVTIDELNNLGHPDNKEQTGQPLAKDKVALLIGNMSY
WEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMCNAVDEFLLLLDKGVYGLLYYAGHGYENFGNS
FMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRNDYDDTIPILDALKVTANIVFGYATC
QGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLLDEVAEDMGKCHLTKGRQALEIRSSLSEKRALTDP
VQGAPCSAEALVRNLQWAKAHELPESMCLKFQCGVHIQLGFAAEFSNVMIIYTSIVHKPPEIIMCDAYVT
DFPLDLDIDPKHANKGTPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLIFTVCLSYQYSGLEDTVEEKQ
EVNVGKPLIAKLDMHRGLGRKTCFQACRMPDEPYHSSTSTSAGAGHFHSSQDSFHDVYHSHLGNADSGMP
PDRCHCSRTPHTFISNYPPHHYCQFGRSNVPVETTDEMPFSFSDRLMISEN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 92.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for at least 3 months from receipt of products under proper storage and handling conditions.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_766421
Locus ID 240354
UniProt ID Q2TBA3
Cytogenetics 18 E1
RefSeq Size 5008
RefSeq ORF 2463
Synonyms A630046N12; D430033E09Rik; Pcasp1
Summary Enhances BCL10-induced activation of NF-kappa-B. Involved in nuclear export of BCL10. Binds to TRAF6, inducing TRAF6 oligomerization and activation of its ligase activity. Has ubiquitin ligase activity (By similarity). MALT1-dependent BCL10 cleavage plays an important role in T-cell antigen receptor-induced integrin adhesion (By similarity). Involved in the induction of T helper 17 cells (Th17) differentiation. Cleaves RC3H1 and ZC3H12A in response to T-cell receptor (TCR) stimulation which releases their cooperatively repressed targets to promote Th17 cell differentiation (PubMed:25282160).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Malt1 (NM_172833) Mouse Recombinant Protein
Your Rating
SKU Description Size Price
LC724110 Malt1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY724110 Transient overexpression lysate of Mouse mucosa associated lymphoid tissue lymphoma translocation gene 1 (Malt1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.