Sacm1l (NM_030692) Mouse Recombinant Protein

SKU
TP524002
Purified recombinant protein of Mouse SAC1 suppressor of actin mutations 1-like (yeast) (Sacm1l), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR224002 representing NM_030692
Red=Cloning site Green=Tags(s)

MAAAAYEHLKLHITPEKFYVEACDDGADDVLIIDRVSTEVTLAVKKDVPPSAVTRPIFGILGTIHLVAGN
YLVVITKKMKVGECFNHAVWRATDFDVLSYKKTMLHLTDIQLQDNKTFLAMLNHVLSMDGFYFSTTYDLT
HTLQRLSNTSPEFQEMSLLERADQRFVWNGHLLRELSAQPEVHRFALPVLHGFITMHSCSINGKYFDWIL
ISRRSCFRAGVRYYVRGIDSEGHAANFVETEQIVHYSGNRASFVQTRGSIPIFWSQRPNLKYKPHPQISK
VANHMDGFQRHFDSQVIIYGKQVIINLVNHKGSEKPLEQTFANMVSSLGSGMIRYIAFDFHKECKNMRWD
RLSILLDQVAEMQDELSYFLVDSAGKVVTNQDGVFRSNCMDCLDRTNVIQSLLARRSLQAQLQRLGVLHV
GQKLEEQDEFEKTYKNAWADNANACAKQYAGTGALKTDFTRTGKRTQLGLLMDGFNSLLRYYKNNFSDGF
RQDSIDLFLGNYSVDELESHSPLSVPRDWKFLALPIIMVVAFSMCIICLLMAGDTWTETLAYVLFWGVAS
IGTFFIILYNGKDFVDAPRLVQKEKID

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 67.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_109617
Locus ID 83493
UniProt ID Q9EP69
Cytogenetics 9 74.08 cM
RefSeq Size 3433
RefSeq ORF 1761
Synonyms mKIAA0851; SA; SAC1; Sac1p
Summary This gene encodes an integral membrane protein, which is localized to the endoplasmic reticulum, and functions as a phosphoinositide phosphatase that hydrolyzes phosphatidylinositol 3-phosphate, phosphatidylinositol 4-phosphate, and phosphatidylinositol 3,5-bisphosphate. Deletion of this gene in mouse results in preimplantation lethality. Other studies suggest that this gene is also involved in the organization of golgi membranes and mitotic spindles. Two isoforms are predicted to be produced from the same mRNA by the use of alternative in-frame translation termination codons via a stop codon readthrough mechanism. [provided by RefSeq, Dec 2017]
Write Your Own Review
You're reviewing:Sacm1l (NM_030692) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.