Brk1 (NM_133937) Mouse Recombinant Protein

SKU TP519863

Purified recombinant protein of Mouse BRICK1, SCAR/WAVE actin-nucleating complex subunit (Brk1), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR219863 representing NM_133937; Red=Cloning site Green=Tags(s); ; MAGQEDPVQREIHQDWANREYIEIITSSIKKISDFLNSFDMSCRSRLATLNEKLTALERRIEYIEARVTK; GETLT; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 9.2 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_598698
• Locus ID: 101314
• UniProt ID: Q91VR8
• Cytogenetics: 6 E3
• RefSeq Size: 1110
• RefSeq ORF: 225
• Synonyms: 6720456B07Rik; AW011779
• Summary: Involved in regulation of actin and microtubule organization. Part of a WAVE complex that activates the Arp2/3 complex (By similarity). As component of the WAVE1 complex, required for BDNF-NTRK2 endocytic trafficking and signaling from early endosomes (PubMed:27605705).[UniProtKB/Swiss-Prot Function]