Icam4 (NM_023892) Mouse Recombinant Protein

SKU
TP519259
Purified recombinant protein of Mouse intercellular adhesion molecule 4, Landsteiner-Wiener blood group (Icam4), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR219259 representing NM_023892
Red=Cloning site Green=Tags(s)

MESALLLPSLLLVAAYPRGGSPQQEWMQSPPAPSVTSAPFWVRLNPELEAVPPGGSAWLNCSHNCPLPVH
SSLRTQLRQGKIVNGSGWVSYQLLDVRAWNSKVRCVVTCAGETREATARITAYKRPRSVILEPPVLVGHK
YTLRCYVTHVFPVGFLVVSLRRGGRVIYHESLERFTGSDLANVTLTYVMRAGLNDLWQPLTCHARLNLDG
LVVRSSSAPVMLTVLALSPASIALASTSIATLVGILLAVGAVYVRKYLAVQT

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 28.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_076381
Locus ID 78369
UniProt ID Q9ERM2
Cytogenetics 9 7.69 cM
RefSeq Size 907
RefSeq ORF 786
Synonyms 1810015M19Rik; Cd242; ICAM-4
Summary Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity). Isoform 2 may modulate binding of membrane-associated ICAM4.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Icam4 (NM_023892) Mouse Recombinant Protein
Your Rating
SKU Description Size Price
TP750228 Purified recombinant protein of intercellular adhesion molecule 4 isoform 1 precursor(Icam4), 23Gln-231Ser 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.