Aplf (NM_001170489) Mouse Recombinant Protein

SKU
TP518907
Purified recombinant protein of Mouse aprataxin and PNKP like factor (Aplf), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR218907 representing NM_001170489
Red=Cloning site Green=Tags(s)

MPSDFFLQPLDGGPRVPVGPGQTVIGRGPLLGITDKRVSRRHAILEVVDSQLRIKPIHRNPCFYQSSEKS
QHSPMETQVWSQLHPGDSFSLLLDKYAFRVFSAESEVEMECTLRNSQMLDEDDILSEMQKSPVVNLPDKT
TGASQLQGSPEITKTKCPTIDPMSSSGECRAFSEHQPRPTQRKRILPAWMLAESLSDQSLSTPAEGGDKD
VIQRSGKAGTCEDRTPGNTSWHGKKRLSPSGNSKSVSAEQDPGKKCRKADQEGPGVSSENVPESSSSNIV
KDPDVDIVKTNKQKDGILIEELGEVSKHKAATKPTTNEEGESCARVQSKSPPEKSQGCHPESSSAPSSPD
ALHTDTADPVLGCSEESKVRRTACMYGANCYRRNPLHFQHFSHPGDSDYGEVHGTDEGVIGDRPECPYGA
SCYRKNPQHKMEYRHSALPARVALDEDDDDVGQPSDDEDEEDYEPTDEDSDWHPGKDDEEQEDVDELLKE
AKSSLHLKH

myc-FLAG tag
Tag C-MYC/DDK
Predicted MW 55.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001163960
Locus ID 72103
UniProt ID Q9D842
Cytogenetics 6 D1
RefSeq Size 3184
RefSeq ORF 1497
Synonyms 2010301N04Rik; AI452191
Summary Nuclease involved in single-strand and double-strand DNA break repair. Recruited to sites of DNA damage through interaction with poly(ADP-ribose), a polymeric post-translational modification synthesized transiently at sites of chromosomal damage to accelerate DNA strand break repair reactions. Displays apurinic-apyrimidinic (AP) endonuclease and 3'-5' exonuclease activities in vitro. Also able to introduce nicks at hydroxyuracil and other types of pyrimidine base damage. Together with PARP3, promotes the retention of the LIG4-XRCC4 complex on chromatin and accelerate DNA ligation during non-homologous end-joining (NHEJ).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Aplf (NM_001170489) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.