H2-Ke6 (NM_013543) Mouse Recombinant Protein

SKU TP518574

Purified recombinant protein of Mouse H2-K region expressed gene 6 (H2-Ke6), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR218574 representing NM_013543; Red=Cloning site Green=Tags(s); ; MASQLRLRSALALVTGAGSGIGRAISVRLAAEGAAVAACDLDGAAAQDTVRLLGSPGSEDGAPRGKHAAF; QADVSQGPAARRLLEEVQACFSRPPSVVVSCAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVTQAAAQAL; VSSGGRGSIINISSIIGKVGNIGQTNYASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKMPE; KVKDKVTAMIPLGHMGDPEDVADVVAFLASEDSGYITGASVEVSGGLFM; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 26.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_038571
• Locus ID: 14979
• UniProt ID: P50171
• Cytogenetics: 17 17.98 cM
• RefSeq Size: 981
• RefSeq ORF: 777
• Synonyms: D17H6S112E; H-2Ke6; Hsd17b8; Ke-6; Ke6; Ring2
• Summary: NAD-dependent 17-beta-hydroxysteroid dehydrogenase with highest activity towards estradiol. Has very low activity towards testosterone (PubMed:9712896). The heterotetramer with CBR4 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity, and thereby plays a role in mitochondrial fatty acid biosynthesis. Within the heterotetramer, HSD17B8 binds NADH; CBR4 binds NADPD.[UniProtKB/Swiss-Prot Function]