Map4k2 (NM_009006) Mouse Recombinant Protein

SKU
TP517131
Purified recombinant protein of Mouse mitogen-activated protein kinase kinase kinase kinase 2 (Map4k2), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
$988.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Mouse
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>MR217131 representing NM_009006
Red=Cloning site Green=Tags(s)

MALLRDVSLQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQEITILRECRH
PNVVAYIGSYLRNDRLWICMEFCGGGSLQEIYHATGPLEERQIAYVCREALKGLHHLHSQGKIHRDIKGA
NLLLTLQGDVKLADFGVSGELTASVAKRRSFIGTPYWMAPEVAAVERKGGYNELCDVWALGITAIELGEL
QPPLFHLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAERLLQHPFTTQHLPPA
LLTQLLDKASDPHLGTLSPEDSELETHDMFPDTIHSRSHHGPAERTPSEIQFHQVKFGAPRRKETDPLNE
PWEEEWTLLGKEELSGSLLQSVQEALEERSLTIRPALELQELDSPDDAIGTIKRAPFLGLPHTESTSGDN
AQSCSPGTLSAPPAGPGSPALLPTAWATLKQQEDRERSSCHGLPPTPKVHMGACFSKVFNGCPLQIHAAV
TWVHPVTRDQFLVVGAEEGIYTLNLHELHEDTMEKLISQRCSWLYCVNNVLLSLSGKSTHIWAHDLPGLF
EQRRLQHQAPLSIPTNRITQRIIPRRFALSTKIPDTKGCLQCRVVRNPYTGSTFLLAALPASLLLLQWYE
PLQKFLLLKNFSSPLPSPAGMLEPLVLDGKELPQVCVGAEGPEGPGCRVLFHVLPLEAGLTPDILIPPEG
IPGSAQQVIQVDRDTVLVSFERCVRIVNLQGEPTAALAPELTFDFTIETVVCLQDSVLAFWSHGMQGRSL
DTNEVTQEITDETRIFRVLGAHRDIILESIPTDNPGAHSNLYILTGHQSSY

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Tag C-MYC/DDK
Predicted MW 91.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C after receiving vials.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_033032
Locus ID 26412
UniProt ID Q61161
Cytogenetics 19 A
RefSeq Size 2466
RefSeq ORF 2463
Synonyms AI385662; BL44; GCK; Rab8ip
Summary Serine/threonine-protein kinase which acts as an essential component of the MAP kinase signal transduction pathway (PubMed:8643544). Acts as a MAPK kinase kinase kinase (MAP4K) and is an upstream activator of the stress-activated protein kinase/c-Jun N-terminal kinase (SAP/JNK) signaling pathway and to a lesser extent of the p38 MAPKs signaling pathway (By similarity). Required for the efficient activation of JNKs by TRAF6-dependent stimuli, including pathogen-associated molecular patterns (PAMPs) such as polyinosine-polycytidine (poly(IC)), lipopolysaccharides (LPS), lipid A, peptidoglycan (PGN), or bacterial flagellin (By similarity). To a lesser degree, IL-1 and engagement of CD40 also stimulate MAP4K2-mediated JNKs activation (By similarity). The requirement for MAP4K2/GCK is most pronounced for LPS signaling, and extends to LPS stimulation of c-Jun phosphorylation and induction of IL-8 (By similarity). Enhances MAP3K1 oligomerization, which may relieve N-terminal mediated MAP3K1 autoinhibition and lead to activation following autophosphorylation (By similarity). Mediates also the SAP/JNK signaling pathway and the p38 MAPKs signaling pathway through activation of the MAP3Ks MAP3K10/MLK2 and MAP3K11/MLK3 (By similarity). May play a role in the regulation of vesicle targeting or fusion (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Map4k2 (NM_009006) Mouse Recombinant Protein
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.