Tyw5 (NM_001037742) Mouse Recombinant Protein

SKU TP516329

Purified recombinant protein of Mouse tRNA-yW synthesizing protein 5 (Tyw5), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug

Product Data

• Species: Mouse
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >MR216329 protein sequence; Red=Cloning site Green=Tags(s); ; MAEQHLPVPRLRGVSREQFMEHLYPQRKPLVLEGLDLGSCTSKWTVDYLSQVGGTKEVKIHVAAVPQMDF; ISKNFVYRTLPFNKLVQRAAEETHKEFFISEDEKYYLRSLGEDPRKDVADIRQQFPSLGGDITFPMFFRE; EQFFSSVFRISSPGLQLWTHYDVMDNFLIQVTGKKRITLFNPRDAQYLYLSGSKSEVLNIDSPDLDKYPL; FPKARRYECSLEAGDVLFIPALWFHNVVSEEFGVGVNIFWKHLPSECYDTTDTYGNKDPVAASRAVQILD; RALKTLAELPEEYRDFYARQMVLRIQDKAYSKNFE; ; myc-FLAG tag
• Tag: C-MYC/DDK
• Predicted MW: 36.6 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C after receiving vials.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001032831
• Locus ID: 68736
• UniProt ID: A2RSX7
• Cytogenetics: 1 C1.3
• RefSeq Size: 1448
• RefSeq ORF: 945
• Synonyms: 1110034B05Rik
• Summary: tRNA hydroxylase that acts as a component of the wybutosine biosynthesis pathway. Wybutosine is a hyper modified guanosine with a tricyclic base found at the 3'-position adjacent to the anticodon of eukaryotic phenylalanine tRNA. Catalyzes the hydroxylation of 7-(a-amino-a-carboxypropyl)wyosine (yW-72) into undermodified hydroxywybutosine (OHyW*). OHyW* being further transformed into hydroxywybutosine (OHyW) by LCMT2/TYW4. OHyW is a derivative of wybutosine found in higher eukaryotes (By similarity).[UniProtKB/Swiss-Prot Function]